SitesBLAST
Comparing Ga0059261_2632 FitnessBrowser__Korea:Ga0059261_2632 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 57% coverage: 46:253/364 of query aligns to 99:327/467 of 7qh2C
- binding flavin-adenine dinucleotide: P137 (≠ H87), G138 (= G88), E139 (≠ D94), A142 (= A97), T143 (= T98), G146 (= G101), N147 (≠ V102), S149 (≠ A104), T150 (≠ A105), A152 (≠ V107), G153 (≠ A108), E203 (≠ W158), G204 (= G159), I209 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 73, 75, 76, 77, 78, 79, 80, 83, 84, 422, 423
- binding fe (iii) ion: 377, 384, 422
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
28% identity, 74% coverage: 1:270/364 of query aligns to 44:282/465 of 3pm9A
- active site: A149 (≠ V107), L159 (≠ G117)
- binding flavin-adenine dinucleotide: P69 (vs. gap), Q70 (≠ G24), G71 (= G25), G72 (= G26), N73 (≠ S27), T74 (≠ K28), G75 (≠ D29), L76 (≠ A30), G79 (vs. gap), Q80 (vs. gap), L91 (≠ M42), L133 (= L91), G134 (= G92), A135 (≠ N93), C139 (≠ A97), T140 (= T98), G142 (= G100), G143 (= G101), S146 (≠ A104), T147 (≠ A105), A149 (≠ V107), G150 (≠ A108), E200 (≠ W158), G201 (= G159), I205 (≠ A163), I206 (≠ L164)
Sites not aligning to the query:
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 59% coverage: 1:213/364 of query aligns to 71:282/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 35% coverage: 45:173/364 of query aligns to 93:213/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
25% identity, 48% coverage: 1:176/364 of query aligns to 103:277/521 of Q8N465
- S109 (≠ I7) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (vs. gap) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G26) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V39) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F45) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T64) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A81) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A104) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G130) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G132) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
25% identity, 48% coverage: 1:176/364 of query aligns to 51:225/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (vs. gap), G78 (= G25), G79 (= G26), N80 (≠ S27), T81 (≠ K28), G82 (≠ D29), M83 (≠ A30), G86 (≠ A33), S87 (≠ P34), L140 (= L91), A142 (≠ N93), C146 (≠ A97), H147 (≠ T98), G150 (= G101), N151 (≠ V102), A153 (= A104), T154 (≠ A105), G208 (= G159), I212 (≠ A163), I213 (≠ L164)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
25% identity, 48% coverage: 1:176/364 of query aligns to 50:224/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (vs. gap), Q76 (≠ G24), G77 (= G25), G78 (= G26), N79 (≠ S27), T80 (≠ K28), G81 (≠ D29), M82 (≠ A30), G85 (≠ A33), S86 (≠ P34), L139 (= L91), G140 (= G92), A141 (≠ N93), C145 (≠ A97), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ A105), G157 (= G109), G207 (= G159), I212 (≠ L164)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
25% identity, 48% coverage: 1:176/364 of query aligns to 50:224/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (vs. gap), G77 (= G25), G78 (= G26), N79 (≠ S27), T80 (≠ K28), G81 (≠ D29), G85 (≠ A33), S86 (≠ P34), L139 (= L91), G140 (= G92), A141 (≠ N93), C145 (≠ A97), H146 (≠ T98), G148 (= G100), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ A105), A155 (≠ V107), E206 (≠ W158), G207 (= G159), I211 (≠ A163), I212 (≠ L164)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
25% identity, 48% coverage: 1:176/364 of query aligns to 50:224/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (vs. gap), G77 (= G25), G78 (= G26), N79 (≠ S27), T80 (≠ K28), G81 (≠ D29), G85 (≠ A33), S86 (≠ P34), L139 (= L91), G140 (= G92), A141 (≠ N93), C145 (≠ A97), H146 (≠ T98), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ A105), A155 (≠ V107), G157 (= G109), E206 (≠ W158), G207 (= G159), I211 (≠ A163), I212 (≠ L164)
- binding d-malate: M82 (≠ A30)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
25% identity, 48% coverage: 1:176/364 of query aligns to 50:224/466 of 6lppA
- binding flavin-adenine dinucleotide: P75 (vs. gap), G77 (= G25), G78 (= G26), N79 (≠ S27), T80 (≠ K28), G81 (≠ D29), M82 (≠ A30), G85 (≠ A33), S86 (≠ P34), L139 (= L91), G140 (= G92), A141 (≠ N93), C145 (≠ A97), G149 (= G101), N150 (≠ V102), A152 (= A104), T153 (≠ A105), A155 (≠ V107), G157 (= G109), G207 (= G159), I212 (≠ L164)
Sites not aligning to the query:
- binding (2R)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 390, 423
- binding flavin-adenine dinucleotide: 39, 422, 423
- binding zinc ion: 381, 388, 422
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
25% identity, 60% coverage: 24:242/364 of query aligns to 142:358/543 of 4bc7B
- binding flavin-adenine dinucleotide: G142 (= G24), G143 (= G25), G144 (= G26), T145 (≠ S27), S146 (≠ K28), V147 (≠ D29), G150 (= G32), L151 (≠ A33), P208 (vs. gap), D209 (vs. gap), S210 (vs. gap), S214 (≠ A97), T215 (= T98), G218 (= G101), S221 (≠ A104), T222 (≠ A105), A224 (≠ V107), S225 (≠ A108), E274 (≠ W158), G275 (= G159), I280 (≠ L164)
Sites not aligning to the query:
Query Sequence
>Ga0059261_2632 FitnessBrowser__Korea:Ga0059261_2632
MLRPANIGELCEVIATGGKLRLRGGGSKDAIGAPCDAQVVDMRGFSGIVDYDPPELVLTV
GAGTPLAQIEALVVGEGQMLAFDPFDHGAMLGNDGGATIGGVVAAGVAGPARLSRGGARD
HLLGFTAVSGRGERFVAGAKVVKNVTGYDLPKLMAGSWGRLAALTEVTLKVLPAPRTRLT
LAMRGLDAAGAVAAMARALGSAAEVTAAAHLPDWRGEAVTALRLDGFAESVAARAAMLPE
FDAIEDADALWRAVRDASPLPREWPLWRLIVAPGKAPGVIAALPDAQWLLDWAGGLIWLT
SDAGPVAIRTAAEAAGGHATLWRASEAMRRAVPALHPQPGALAAIEARVRRAFDPGGVFE
TGRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory