SitesBLAST
Comparing Ga0059261_2635 FitnessBrowser__Korea:Ga0059261_2635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
76% identity, 98% coverage: 7:399/402 of query aligns to 2:393/395 of 3ekgA
- active site: K178 (= K183), P180 (= P185), G184 (= G189), S186 (≠ A191), E190 (= E195), D215 (= D220), W217 (= W222), E241 (= E247), T266 (= T272), G268 (= G274), E269 (= E275), Q290 (= Q296), D292 (= D298), H319 (= H325), E339 (= E345), D348 (≠ T354)
- binding magnesium ion: D215 (= D220), E241 (= E247), E269 (= E275)
P77215 L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 from Escherichia coli (strain K12) (see paper)
64% identity, 97% coverage: 9:399/402 of query aligns to 3:399/401 of P77215
- H29 (= H28) mutation to N: Loss of L-rhamnonate dehydratase activity due to absence of substrate binding.
- H277 (= H276) mutation to N: 35-fold decrease in L-rhamnonate dehydratase activity. 59-fold decrease in substrate affinity.
- H325 (= H325) mutation to N: Loss of L-rhamnonate dehydratase activity. 2-fold decrease in substrate affinity.
3d46A Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and l-tartrate
63% identity, 98% coverage: 9:401/402 of query aligns to 7:405/405 of 3d46A
- active site: K189 (= K183), P191 (= P185), G195 (= G189), H197 (≠ A191), A201 (≠ E195), D226 (= D220), W228 (= W222), E252 (= E247), T277 (= T272), E280 (= E275), Q300 (= Q296), D302 (= D298), H329 (= H325), E349 (= E345), P362 (= P358)
- binding magnesium ion: D226 (= D220), E252 (= E247), E280 (= E275)
3cxoB Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
63% identity, 98% coverage: 9:401/402 of query aligns to 4:402/402 of 3cxoB
- active site: Y52 (= Y50), K186 (= K183), P188 (= P185), G192 (= G189), H194 (≠ A191), A198 (≠ E195), D223 (= D220), W225 (= W222), E249 (= E247), T274 (= T272), G276 (= G274), E277 (= E275), Q297 (= Q296), D299 (= D298), H326 (= H325), E346 (= E345), S351 (≠ H350)
- binding (2R,4S)-2,4,7-trihydroxyheptanoic acid: H30 (= H28), I42 (= I40), R56 (= R54), K186 (= K183), P188 (= P185), D223 (= D220), W225 (= W222), E277 (= E275), H326 (= H325), E346 (= E345)
- binding magnesium ion: D223 (= D220), E249 (= E247), E277 (= E275)
3cxoA Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
63% identity, 98% coverage: 9:401/402 of query aligns to 4:402/402 of 3cxoA
- active site: Y52 (= Y50), K186 (= K183), P188 (= P185), G192 (= G189), H194 (≠ A191), A198 (≠ E195), D223 (= D220), W225 (= W222), E249 (= E247), T274 (= T272), G276 (= G274), E277 (= E275), Q297 (= Q296), D299 (= D298), H326 (= H325), E346 (= E345), S351 (≠ H350)
- binding 3,6-dideoxy-L-arabino-hexonic acid: W37 (= W35), R56 (= R54), K186 (= K183), D223 (= D220), W225 (= W222), E277 (= E275), H326 (= H325), E346 (= E345)
- binding magnesium ion: D223 (= D220), E249 (= E247), E277 (= E275)
3fxgA Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
49% identity, 95% coverage: 9:390/402 of query aligns to 7:389/407 of 3fxgA
- active site: K184 (= K183), P186 (= P185), E196 (= E195), D221 (= D220), Y223 (≠ W222), E247 (= E247), G273 (= G274), E274 (= E275), Q295 (= Q296), D297 (= D298), H324 (= H325), E344 (= E345)
- binding magnesium ion: D221 (= D220), E247 (= E247), E274 (= E275)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
32% identity, 81% coverage: 65:390/402 of query aligns to 44:375/386 of 3sqsA
- active site: L62 (≠ T82), N65 (≠ E85), S147 (vs. gap), K173 (= K183), R175 (≠ P185), G177 (≠ H187), G179 (= G189), K181 (≠ A191), A185 (≠ E195), E210 (≠ D220), Y212 (≠ W222), E236 (= E247), G261 (= G274), E262 (= E275), H263 (= H276), Q283 (= Q296), D285 (= D298), I307 (≠ V320), H312 (= H325), G314 (≠ S327), E332 (= E345), F337 (≠ H350)
- binding magnesium ion: E210 (≠ D220), E236 (= E247), E262 (= E275), Y347 (≠ A361), F350 (≠ L364), D351 (≠ L365)
3stpA Crystal structure of a putative galactonate dehydratase
32% identity, 81% coverage: 65:390/402 of query aligns to 48:379/390 of 3stpA
- active site: L66 (≠ G84), S69 (≠ A87), S151 (≠ T167), K177 (= K183), R179 (≠ P185), P189 (≠ E195), E214 (≠ D220), Y216 (≠ W222), E240 (= E247), G265 (= G274), E266 (= E275), H267 (= H276), Q287 (= Q296), D289 (= D298), I311 (≠ V320), H316 (= H325), E336 (= E345), F341 (≠ H350)
- binding magnesium ion: E214 (≠ D220), E240 (= E247), E266 (= E275)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
32% identity, 82% coverage: 65:392/402 of query aligns to 32:368/378 of 4hpnA
- active site: G50 (= G83), R53 (≠ E85), T134 (= T167), K164 (= K183), K166 (≠ P185), D194 (= D220), N196 (≠ W222), E220 (= E247), G245 (= G274), E246 (= E275), T247 (≠ H276), Q267 (= Q296), D269 (= D298), H296 (= H325), V297 (= V329), W298 (≠ Y330), R320 (≠ E355), E329 (vs. gap), F330 (vs. gap), H334 (vs. gap)
- binding calcium ion: D194 (= D220), D209 (≠ H235), E220 (= E247), G237 (≠ N264), E246 (= E275)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
34% identity, 65% coverage: 66:325/402 of query aligns to 23:280/351 of 5olcC
- active site: K148 (= K183), K150 (≠ P185), D178 (= D220), N180 (≠ W222), E204 (= E247), G229 (= G274), E230 (= E275), D253 (= D298), H280 (= H325)
- binding magnesium ion: D178 (= D220), E204 (= E247), E230 (= E275)
Sites not aligning to the query:
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
30% identity, 75% coverage: 95:397/402 of query aligns to 67:371/373 of 3sjnA
- active site: T139 (= T167), K165 (= K183), G167 (≠ P185), M171 (≠ E192), D198 (= D228), A200 (= A230), E225 (= E247), I247 (≠ V271), G250 (= G274), E251 (= E275), S252 (≠ H276), Q272 (= Q296), D274 (= D298), H301 (= H325), G302 (= G326), F303 (≠ S327), M325 (≠ A344), E326 (= E345), Q329 (≠ T354), S331 (≠ V356)
- binding magnesium ion: D198 (= D228), E225 (= E247), E251 (= E275)
Sites not aligning to the query:
3mqtE Crystal structure of a mandelate racemase/muconate lactonizing enzyme from shewanella pealeana
29% identity, 82% coverage: 63:390/402 of query aligns to 17:366/378 of 3mqtE
- active site: G37 (= G84), E40 (≠ A87), R87 (≠ K124), T130 (= T167), K154 (vs. gap), K164 (= K183), C166 (≠ P185), N170 (≠ G189), D198 (= D220), C199 (= C221), L200 (≠ W222), I224 (= I246), E225 (= E247), R246 (≠ L270), A250 (≠ G274), E251 (= E275), M252 (≠ H276), S269 (≠ D293), Q272 (= Q296), D274 (= D298), H301 (= H325), N302 (≠ G326), E326 (= E345), D331 (≠ G352)
- binding magnesium ion: D198 (= D220), E225 (= E247), E251 (= E275)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
28% identity, 81% coverage: 65:390/402 of query aligns to 32:348/357 of 3ck5A
- active site: T50 (≠ A79), G137 (= G156), K164 (= K183), K166 (≠ P185), D195 (= D220), N197 (≠ W222), I220 (= I246), E221 (= E247), I243 (≠ V271), G246 (= G274), E247 (= E275), E268 (≠ Q296), D270 (= D298), H297 (= H325), G298 (= G326), V299 (≠ S327), Y315 (≠ F346), E317 (≠ M348)
- binding magnesium ion: D195 (= D220), E221 (= E247), E247 (= E275)
Sites not aligning to the query:
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
28% identity, 81% coverage: 65:390/402 of query aligns to 32:351/361 of Q9RKF7
- D195 (= D220) binding
- E221 (= E247) binding
- E247 (= E275) binding
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
29% identity, 78% coverage: 40:351/402 of query aligns to 37:352/395 of 2pp3A
- active site: K45 (≠ E49), S78 (≠ T81), K192 (= K183), A194 (= A191), D223 (= D220), N225 (≠ W222), E249 (= E247), G274 (= G274), E275 (= E275), D298 (= D298), H325 (= H325), E345 (= E345)
- binding l-glucaric acid: D43 (≠ K46), K79 (≠ T82), K192 (= K183), D223 (= D220), N225 (≠ W222), E275 (= E275), H325 (= H325), E345 (= E345), F347 (= F346)
- binding magnesium ion: D223 (= D220), E249 (= E247), E275 (= E275)
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
29% identity, 78% coverage: 40:351/402 of query aligns to 37:352/395 of 2pp1A
- active site: K45 (≠ E49), S78 (≠ T81), K192 (= K183), K194 (≠ P185), D223 (= D220), N225 (≠ W222), E249 (= E247), G274 (= G274), E275 (= E275), D298 (= D298), H325 (= H325), E345 (= E345)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: D43 (≠ K46), K45 (≠ E49), K79 (≠ T82), F168 (vs. gap), K194 (≠ P185), E275 (= E275), H325 (= H325), E345 (= E345)
- binding magnesium ion: D223 (= D220), E249 (= E247), E275 (= E275)
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 76% coverage: 40:345/402 of query aligns to 40:348/398 of Q8ZL58
- D-AK 46:48 (≠ KYPE 46:49) binding
- KR 82:83 (≠ T- 82) binding
- K195 (= K183) binding
- K197 (≠ P185) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D220) binding
- N228 (≠ W222) binding
- E252 (= E247) binding
- E278 (= E275) binding
- H328 (= H325) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E345) binding
4hnlA Crystal structure of enolase egbg_01401 (target efi-502226) from enterococcus gallinarum eg2
27% identity, 83% coverage: 65:398/402 of query aligns to 24:380/401 of 4hnlA
- active site: S35 (≠ I76), F42 (≠ G83), R45 (≠ E85), G85 (= G125), P86 (≠ L126), R153 (≠ A174), Q155 (≠ E176), Q167 (≠ H188), P172 (≠ G193), D207 (= D220), H209 (≠ W222), E233 (= E247), G258 (= G274), E259 (= E275), L260 (≠ H276), R280 (≠ Q296), H282 (≠ D298), H309 (= H325), P311 (≠ S327), E336 (= E345)
- binding magnesium ion: D207 (= D220), E233 (= E247), E259 (= E275)
Sites not aligning to the query:
C8ZZN2 D-galactonate dehydratase family member EGBG_01401 from Enterococcus gallinarum (strain EG2) (see paper)
27% identity, 83% coverage: 65:398/402 of query aligns to 22:378/399 of C8ZZN2
- D205 (= D220) binding
- E231 (= E247) binding
- E257 (= E275) binding
2qq6B Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from rubrobacter xylanophilus dsm 9941
29% identity, 74% coverage: 99:397/402 of query aligns to 55:387/396 of 2qq6B
- active site: G79 (vs. gap), D124 (vs. gap), K166 (= K183), D168 (vs. gap), D213 (= D220), H215 (≠ W222), E239 (= E247), G264 (= G274), E265 (= E275), M286 (≠ Q296), D288 (= D298), H315 (= H325), N316 (≠ G326), E340 (≠ H350), D345 (vs. gap)
- binding magnesium ion: D213 (= D220), E239 (= E247), E265 (= E275), H315 (= H325)
Sites not aligning to the query:
Query Sequence
>Ga0059261_2635 FitnessBrowser__Korea:Ga0059261_2635
MTEGKFVGLPRIKYVRAYTVRGGGADYHDQGAGHWIDDHIATPMSKYPEYRQSRQSFGIN
VLGTLVVELEAEDGTIGFAVTTGGEPACFIVEKHLSRFLIGRDPSDYETIWDQMYFSTQY
YGRKGLVVNAISGVDLAIWDLLGKLRQEPVYHLLGGAVRDEMQFYATGARPDLAKEMGFI
GGKLPLHHGPAEGEEGMEKNIALLADMRAKCGDDFWLMYDCWMALDIDYATRLAHRAWNE
CGLKWIEEALSPDDYWGYAQLKKNAPDGLLVTTGEHESTRWGFRMLLEMECCDIIQPDVG
WCGGVTELIKIADDADRKGVLMVPHGSSVYSYHFVVTRHNSPFAEFLMMHPGPTEVVPMF
APQLLGEPVPVNGKIRASELDKPGFGVELNRDIALHRPYPND
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory