Comparing Ga0059261_2636 FitnessBrowser__Korea:Ga0059261_2636 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
60% identity, 99% coverage: 2:282/284 of query aligns to 7:282/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
60% identity, 99% coverage: 2:282/284 of query aligns to 7:282/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
45% identity, 74% coverage: 71:279/284 of query aligns to 70:276/279 of 6v77B
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
42% identity, 71% coverage: 71:273/284 of query aligns to 69:269/277 of 6iymA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
38% identity, 74% coverage: 63:272/284 of query aligns to 84:294/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
38% identity, 74% coverage: 63:272/284 of query aligns to 85:295/303 of 8sutA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
38% identity, 72% coverage: 72:275/284 of query aligns to 64:257/265 of 3r6oA
Q8R0F8 Oxaloacetate decarboxylase, mitochondrial; OAA decarboxylase; ODx; Acylpyruvase FAHD1; Acylpyruvate hydrolase; ApH; Fumarylacetoacetate hydrolase domain-containing protein 1; EC 4.1.1.112; EC 3.7.1.5 from Mus musculus (Mouse) (see paper)
37% identity, 72% coverage: 71:275/284 of query aligns to 15:213/221 of Q8R0F8
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
37% identity, 72% coverage: 71:275/284 of query aligns to 12:210/216 of 6sbiA
Q6P587 Oxaloacetate decarboxylase, mitochondrial; OAA decarboxylase; ODx; Acylpyruvase FAHD1; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; YisK-like protein; EC 4.1.1.112; EC 3.7.1.5 from Homo sapiens (Human) (see 4 papers)
37% identity, 71% coverage: 71:271/284 of query aligns to 15:209/221 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
37% identity, 71% coverage: 71:271/284 of query aligns to 13:207/218 of 6fogA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
41% identity, 71% coverage: 72:272/284 of query aligns to 63:241/252 of 3qdfA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 73% coverage: 66:272/284 of query aligns to 63:270/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
36% identity, 73% coverage: 66:272/284 of query aligns to 63:270/280 of 6j5xA
1gttA Crystal structure of hpce (see paper)
41% identity, 62% coverage: 73:248/284 of query aligns to 225:392/421 of 1gttA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
39% identity, 71% coverage: 72:272/284 of query aligns to 63:263/269 of 4dbhA
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
34% identity, 74% coverage: 72:282/284 of query aligns to 78:264/264 of 6jvwB
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
35% identity, 65% coverage: 70:254/284 of query aligns to 23:214/233 of 6j5yA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
35% identity, 62% coverage: 72:248/284 of query aligns to 17:197/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
31% identity, 70% coverage: 67:265/284 of query aligns to 5:219/247 of 1nkqA
>Ga0059261_2636 FitnessBrowser__Korea:Ga0059261_2636
MKLCRYGAPGAEKPGLIDADGRIRDLSNYVADIDAQTLSKETLAKLAGVDPATLKLVEGE
VRYGPCVTGTRQFVAIGLNYADHAAESNLPIPEEPVVFNKWVSCIQGPNDPVTIPKDSKK
TDWEVELGIVIGTAAHNVSEADALDHVAGYCVVNDVSERHWQTERGMTWDKGKGFPTFGP
IGPWMVTADEVGDPQNLSMWLSVNGKKVQDGNTRTMIFTVAQIVSYLSQIMTLLPGDVIT
TGTPPGVGLGQKPEPWYLKAGDVVELGIEKLGEQRQDFVAWQAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory