SitesBLAST
Comparing Ga0059261_2637 FitnessBrowser__Korea:Ga0059261_2637 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
59% identity, 97% coverage: 9:247/247 of query aligns to 7:251/251 of 6d9yB
- active site: G20 (= G22), S145 (= S141), Y158 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G16 (= G18), R19 (≠ A21), G20 (= G22), D40 (= D42), L41 (≠ I43), V64 (vs. gap), D65 (= D61), Q66 (= Q62), A93 (= A89), S145 (= S141), Y158 (= Y154), K162 (= K158), P188 (= P184), A189 (= A185), A190 (= A186), A191 (≠ V187), T193 (= T189)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 96% coverage: 8:243/247 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G22), N111 (= N113), S139 (= S141), Q149 (≠ A151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (≠ N95), K98 (≠ T100), S139 (= S141), N146 (= N148), V147 (≠ P149), Q149 (≠ A151), Y152 (= Y154), F184 (≠ A186), M189 (≠ I191), K200 (≠ F202)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ A21), G18 (= G22), I19 (= I23), D38 (= D42), F39 (≠ I43), V59 (= V60), D60 (= D61), V61 (≠ Q62), N87 (≠ S88), A88 (= A89), G89 (= G90), I90 (= I91), T137 (≠ I139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (≠ A186), T185 (≠ V187), T187 (= T189), M189 (≠ I191)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
39% identity, 96% coverage: 7:243/247 of query aligns to 1:244/248 of 6ixmC
- active site: G16 (= G22), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (≠ A21), G16 (= G22), I17 (= I23), D36 (= D42), I37 (= I43), A61 (≠ V60), D62 (= D61), T63 (≠ Q62), N89 (≠ S88), A90 (= A89), M140 (≠ I139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), A186 (= A185), Y187 (≠ A186), I188 (≠ V187), L192 (≠ I191)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
41% identity, 95% coverage: 9:243/247 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G22), S142 (= S141), Q152 (≠ A151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ A20), R15 (≠ A21), G16 (= G22), I17 (= I23), N35 (vs. gap), Y36 (≠ W41), N37 (≠ D42), G38 (≠ I43), S39 (= S44), N63 (≠ D74), V64 (= V75), N90 (≠ S88), A91 (= A89), I93 (= I91), I113 (= I112), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), I188 (≠ V187), T190 (= T189)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
44% identity, 94% coverage: 12:243/247 of query aligns to 6:236/240 of 4dmmB
- active site: G16 (= G22), S142 (= S141), Q152 (≠ A151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ A20), R15 (≠ A21), G16 (= G22), I17 (= I23), A37 (≠ I43), S38 (= S44), S39 (≠ D45), A62 (≠ V60), D63 (= D61), V64 (≠ Q62), N90 (≠ S88), A91 (= A89), L113 (≠ I112), I140 (= I139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), G186 (≠ A185), I188 (≠ V187), T190 (= T189), M192 (= M195)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
38% identity, 94% coverage: 12:243/247 of query aligns to 2:248/253 of 4nbwA
- active site: G12 (= G22), S146 (= S141), Y159 (= Y154), K163 (= K158)
- binding nicotinamide-adenine-dinucleotide: G8 (= G18), N11 (≠ A21), G12 (= G22), I13 (= I23), D32 (= D42), L33 (≠ I43), V57 (= V60), D58 (= D61), V59 (≠ Q62), N85 (≠ S88), A86 (= A89), G87 (= G90), S146 (= S141), Y159 (= Y154), K163 (= K158), I192 (≠ V187), T194 (= T189)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 96% coverage: 12:247/247 of query aligns to 6:246/248 of Q9KJF1
- S15 (≠ A21) binding
- D36 (= D42) binding
- D62 (= D61) binding
- I63 (≠ Q62) binding
- N89 (≠ S88) binding
- Y153 (= Y154) binding
- K157 (= K158) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
37% identity, 96% coverage: 12:247/247 of query aligns to 5:245/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), M16 (≠ I23), D35 (= D42), I36 (= I43), I62 (≠ Q62), N88 (≠ S88), G90 (= G90), I138 (= I139), S140 (= S141), Y152 (= Y154), K156 (= K158), I185 (≠ V187)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
39% identity, 95% coverage: 9:243/247 of query aligns to 3:240/244 of 6t77A
- active site: G16 (= G22), S138 (= S141), Y151 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (≠ A20), R15 (≠ A21), T37 (≠ I43), L58 (≠ V60), N59 (≠ D61), V60 (≠ Q62), A87 (= A89), G88 (= G90), I89 (= I91)
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
34% identity, 96% coverage: 8:243/247 of query aligns to 2:260/260 of 1zemA
- active site: N16 (≠ G22), S142 (= S141), Y155 (= Y154), K159 (= K158), D212 (≠ M195)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), G15 (≠ A21), N16 (≠ G22), I17 (= I23), D36 (= D42), M37 (≠ I43), D62 (= D61), V63 (≠ Q62), N89 (≠ S88), A90 (= A89), G91 (= G90), T140 (≠ I139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), M188 (vs. gap)
1iy8A Crystal structure of levodione reductase (see paper)
36% identity, 96% coverage: 8:245/247 of query aligns to 1:255/258 of 1iy8A
- active site: G15 (= G22), S143 (= S141), Q153 (≠ A151), Y156 (= Y154), K160 (= K158)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), S14 (≠ A21), G15 (= G22), L16 (≠ I23), D35 (= D42), V36 (≠ I43), A62 (≠ V60), D63 (= D61), V64 (≠ Q62), N90 (≠ S88), G92 (= G90), I93 (= I91), T141 (≠ I139), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (≠ A185), T191 (= T189), P192 (≠ A190), M193 (≠ I191)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
36% identity, 96% coverage: 8:245/247 of query aligns to 10:264/267 of Q9LBG2
- 17:42 (vs. 15:40, 58% identical) binding
- E103 (≠ T92) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 95% coverage: 9:243/247 of query aligns to 3:240/244 of P0A2C9
- M125 (= M128) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A226) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S227) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
5vmlA Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound NADP
36% identity, 94% coverage: 12:243/247 of query aligns to 3:241/245 of 5vmlA
- active site: G13 (= G22), N111 (= N113), S139 (= S141), Y152 (= Y154), K156 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G18), G12 (≠ A21), G13 (= G22), I14 (= I23), C33 (vs. gap), G34 (vs. gap), R39 (vs. gap), G59 (≠ A58), N60 (≠ K59), V61 (= V60), N87 (≠ S88), G89 (= G90), I90 (= I91), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), G183 (≠ A185), I185 (≠ V187)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 95% coverage: 9:243/247 of query aligns to 3:240/244 of P0AEK2
- GASR 12:15 (≠ GGAA 18:21) binding
- T37 (≠ I43) binding
- NV 59:60 (≠ DQ 61:62) binding
- N86 (≠ S88) binding
- Y151 (= Y154) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSTSK 154:158) binding
- A154 (≠ S157) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K158) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ V187) binding
- E233 (≠ A236) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 95% coverage: 9:243/247 of query aligns to 2:239/243 of 1q7bA
- active site: G15 (= G22), E101 (≠ A105), S137 (= S141), Q147 (≠ A151), Y150 (= Y154), K154 (= K158)
- binding calcium ion: E232 (≠ A236), T233 (≠ V237)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), S13 (≠ A20), R14 (≠ A21), T36 (≠ I43), N58 (≠ D61), V59 (≠ Q62), N85 (≠ S88), A86 (= A89), G87 (= G90), I88 (= I91), S137 (= S141), Y150 (= Y154), K154 (= K158), P180 (= P184), G181 (≠ A185), I183 (≠ V187)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 94% coverage: 12:243/247 of query aligns to 5:243/246 of 3osuA
7krmC Putative fabg bound to nadh from acinetobacter baumannii
37% identity, 95% coverage: 9:243/247 of query aligns to 3:240/244 of 7krmC
- active site: G18 (= G22), S140 (= S141), Y155 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (≠ A21), G18 (= G22), I19 (= I23), D38 (= D42), L39 (≠ I43), A60 (≠ V60), N61 (≠ D61), V62 (≠ Q62), N88 (≠ S88), V111 (≠ I112), S140 (= S141), Y155 (= Y154), K159 (= K158), I188 (≠ V187), T190 (= T189)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
37% identity, 95% coverage: 9:243/247 of query aligns to 2:239/243 of 1q7cA
- active site: G15 (= G22), S137 (= S141), Q147 (≠ A151), F150 (≠ Y154), K154 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G18), S13 (≠ A20), R14 (≠ A21), A35 (≠ D42), T36 (≠ I43), L57 (≠ V60), N58 (≠ D61), V59 (≠ Q62), G87 (= G90), I88 (= I91)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 94% coverage: 12:243/247 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G22), S138 (= S141), Q148 (≠ A151), Y151 (= Y154), K155 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G18), S10 (≠ A20), R11 (≠ A21), I13 (= I23), N31 (vs. gap), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (vs. gap), A58 (= A58), N59 (≠ K59), V60 (= V60), N86 (≠ S88), A87 (= A89), T109 (≠ I112), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (≠ A185)
Query Sequence
>Ga0059261_2637 FitnessBrowser__Korea:Ga0059261_2637
MAGQVSGRFAGRVAVVTGGAAGIGRAAAERMAAEGAQVSVWDISDEALAGCDFAAHTAKV
DQSDEAQVIAAAADVAARLGRLDILVVSAGITGPNTTLETYPSDAWQQVMAINLNGTFFC
DKAVIPHMKANGYGRIVNIASVAGKEGNPNASAYSTSKAGVIGLTKSLGKELAKDNITVN
AVTPAAVKTAIFDQMTQAHIDFMLSKIPMGRFGTVDENAAMICFLASEEASFSTGAVFDT
SGGRATY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory