Comparing Ga0059261_2643 FitnessBrowser__Korea:Ga0059261_2643 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
6lvwA Polyextremophilic beta-galactosidase from the antarctic haloarchaeon halorubrum lacusprofundi (see paper)
36% identity, 85% coverage: 37:622/687 of query aligns to 1:601/668 of 6lvwA
1kwkA Crystal structure of thermus thermophilus a4 beta-galactosidase in complex with galactose (see paper)
34% identity, 92% coverage: 39:670/687 of query aligns to 2:631/644 of 1kwkA
1kwgA Crystal structure of thermus thermophilus a4 beta-galactosidase (see paper)
34% identity, 92% coverage: 39:670/687 of query aligns to 2:631/644 of 1kwgA
O69315 Beta-galactosidase; Beta-gal; Lactase; EC 3.2.1.23 from Thermus thermophilus (see paper)
34% identity, 92% coverage: 39:670/687 of query aligns to 2:631/645 of O69315
5e9aB Crystal structure analysis of the cold-adamped beta-galactosidase from rahnella sp. R3 (see paper)
33% identity, 85% coverage: 40:622/687 of query aligns to 16:614/684 of 5e9aB
3ttyA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus in complex with galactose (see paper)
29% identity, 95% coverage: 35:685/687 of query aligns to 7:673/675 of 3ttyA
3ttsA Crystal structure of beta-galactosidase from bacillus circulans sp. Alkalophilus (see paper)
29% identity, 95% coverage: 35:685/687 of query aligns to 7:673/675 of 3ttsA
5dfaA 3d structure of the e323a catalytic mutant of gan42b, a gh42 beta- galactosidase from g. Stearothermophilus (see paper)
32% identity, 86% coverage: 37:630/687 of query aligns to 14:623/685 of 5dfaA
8ibtA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e318s mutant in complex with lacto-n-tetraose (see paper)
31% identity, 88% coverage: 33:639/687 of query aligns to 15:637/694 of 8ibtA
4uzsA Crystal structure of bifidobacterium bifidum beta-galactosidase (see paper)
30% identity, 89% coverage: 40:647/687 of query aligns to 21:632/687 of 4uzsA
Sites not aligning to the query:
8ibsA Crystal structure of gh42 beta-galactosidase bibga42a from bifidobacterium longum subspecies infantis e160a/e318a mutant in complex with galactose (see paper)
30% identity, 88% coverage: 33:639/687 of query aligns to 15:637/691 of 8ibsA
4ucfA Crystal structure of bifidobacterium bifidum beta-galactosidase in complex with alpha-galactose (see paper)
31% identity, 82% coverage: 40:604/687 of query aligns to 20:601/682 of 4ucfA
Sites not aligning to the query:
4uniA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 in complex with galactose (see paper)
30% identity, 89% coverage: 37:646/687 of query aligns to 17:635/689 of 4uniA
4uozA Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. Lactis bl-04 nucleophile mutant e324a in complex with galactose (see paper)
30% identity, 89% coverage: 37:646/687 of query aligns to 16:634/688 of 4uozA
O31529 Beta-galactosidase YesZ; Beta-gal; Probable rhamnogalacturonan beta-galactosidase; EC 3.2.1.23 from Bacillus subtilis (strain 168) (see paper)
27% identity, 92% coverage: 40:668/687 of query aligns to 7:638/663 of O31529
O58247 Exo-beta-D-glucosaminidase; GlcNase; EC 3.2.1.- from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
20% identity, 84% coverage: 27:601/687 of query aligns to 11:624/778 of O58247
>Ga0059261_2643 FitnessBrowser__Korea:Ga0059261_2643
MRTILLAAAAALALAPAVSAQTVFPNRATAFADKPAIAVGVAWYPEQWPEDRWAVDLDMM
KASGFNTVRIGEFAWARMEPEEGKFDFAWMDRAIAAAVKRGFMVVIGTPSAAPPAWLTQN
YPDTLRVDENGQRASHGGRRHFSFASRRYRELSRRIAVEMATRYGKHPSVVGWQVDNEVG
PPSWDAESVAAWHAFLKQRYGTIDALNRRWTTQYWSQFYNDWSQIPLRQTGQQNPGLLLD
FRHFTTAVWTDYIQNQARAIRPLIDRRAWITTNTMFWNAGFDHFVMHRDLDLASWDNYIP
DGRPDWVANGANHALVRGYKQRNFWLMETQPGRVDWVPVNRALDPGQVRELAWQSVSHGS
DGVLYWQWRPARNGQETYHGAVLGQDGEPNPIHAEITQIAKELTAAAPLLADTGPAAKVA
MLWSYDSRWAIDLQRHHRDFDPVKAFTDVYRPLRVQSQGVHVVSPDAALAAYPLVVAPNL
NVVTQAQADRLAAYVRGGGHLVLGPRSGMKDDANALWPQRQPGPLSDLLGAMVEQYYALD
APVGIKGELGKGKVAIWAEEIRPDAVDVRVIATYTDPGGWLDGKPAAVTRKVGRGSITYF
GAWLDPATMNTLAARLLGEAKIAPLIPEAHADLEISERAGGGKRVMIVINHGTGARPLTP
PSGARFVSGDWAGGQMKAHGVALFQLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory