SitesBLAST
Comparing Ga0059261_2661 FitnessBrowser__Korea:Ga0059261_2661 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cb3A Crystal structure of l-talarate dehydratase from polaromonas sp. Js666 complexed with mg and l-glucarate
31% identity, 90% coverage: 2:344/383 of query aligns to 3:356/373 of 3cb3A
- active site: K24 (≠ N23), S57 (vs. gap), T143 (≠ A128), K171 (= K156), K173 (= K158), D202 (= D189), N204 (= N191), E228 (= E216), G253 (= G241), E254 (= E242), M275 (≠ Q263), D277 (≠ G265), H304 (≠ G291), F305 (≠ Y292), A306 (≠ N293), E324 (= E311)
- binding l-glucaric acid: K171 (= K156), K173 (= K158), D202 (= D189), E254 (= E242), H304 (≠ G291)
- binding magnesium ion: D202 (= D189), E228 (= E216), A243 (≠ S231), F246 (≠ C234), E254 (= E242)
2og9A Crystal structure of mandelate racemase/muconate lactonizing enzyme from polaromonas sp. Js666
33% identity, 82% coverage: 30:344/383 of query aligns to 22:345/363 of 2og9A
- active site: S46 (vs. gap), T132 (≠ A128), K160 (= K156), K162 (= K158), D191 (= D189), N193 (= N191), E217 (= E216), G242 (= G241), E243 (= E242), M264 (≠ Q263), D266 (≠ G265), H293 (≠ G291), F294 (≠ Y292), A295 (≠ N293), E313 (= E311)
- binding calcium ion: A232 (≠ S231), F235 (≠ C234)
Q9RKF7 3,6-anhydro-alpha-L-galactonate cycloisomerase; AHGA cycloisomerase; EC 5.5.1.25 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
33% identity, 74% coverage: 64:345/383 of query aligns to 72:351/361 of Q9RKF7
- D195 (= D189) binding
- E221 (= E216) binding
- E247 (= E242) binding
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
29% identity, 75% coverage: 60:345/383 of query aligns to 71:353/367 of 5xd8B
- active site: G140 (≠ S129), K167 (= K156), K169 (= K158), D198 (= D189), N200 (= N191), E224 (= E216), G249 (= G241), E250 (= E242), Q271 (= Q263), D273 (vs. gap), H300 (≠ V290), G301 (= G291), M302 (≠ Y292), W317 (≠ G309), E319 (= E311), P324 (≠ N316)
- binding magnesium ion: D198 (= D189), E224 (= E216), E250 (= E242)
Sites not aligning to the query:
Q8ZL58 L-talarate/galactarate dehydratase; TalrD/GalrD; StTGD; EC 4.2.1.156; EC 4.2.1.42 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 86% coverage: 18:348/383 of query aligns to 43:384/398 of Q8ZL58
- DAK 46:48 (≠ DVN 21:23) binding
- KR 82:83 (vs. gap) binding
- K195 (= K156) binding
- K197 (= K158) active site, Proton acceptor; mutation to A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- D226 (= D189) binding
- N228 (= N191) binding
- E252 (= E216) binding
- E278 (= E242) binding
- H328 (≠ G291) active site, Proton donor/acceptor; mutation H->N,A: Loss of dehydration activity on both L-talarate and galactarate and loss of epimerization activity.
- E348 (= E311) binding
2pp1A Crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate (see paper)
31% identity, 86% coverage: 18:348/383 of query aligns to 40:381/395 of 2pp1A
- active site: K45 (≠ N23), S78 (vs. gap), K192 (= K156), K194 (= K158), D223 (= D189), N225 (= N191), E249 (= E216), G274 (= G241), E275 (= E242), D298 (≠ G265), H325 (≠ G291), E345 (= E311)
- binding (2r,3s,4r)-2,3,4-trihydroxy-5-(hydroxyamino)-5-oxopentanoic acid: D43 (= D21), K45 (≠ N23), K79 (vs. gap), F168 (≠ C132), K194 (= K158), E275 (= E242), H325 (≠ G291), E345 (= E311)
- binding magnesium ion: D223 (= D189), E249 (= E216), E275 (= E242)
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
33% identity, 74% coverage: 64:345/383 of query aligns to 72:348/357 of 3ck5A
- active site: G137 (≠ S129), K164 (= K156), K166 (= K158), D195 (= D189), N197 (= N191), I220 (= I215), E221 (= E216), I243 (≠ V238), G246 (= G241), E247 (= E242), E268 (≠ Q263), D270 (vs. gap), H297 (≠ V290), G298 (= G291), V299 (≠ Y292), Y315 (≠ G309), E317 (= E311)
- binding magnesium ion: D195 (= D189), E221 (= E216), E247 (= E242)
Sites not aligning to the query:
2pp3A Crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate (see paper)
31% identity, 86% coverage: 18:348/383 of query aligns to 40:381/395 of 2pp3A
- active site: K45 (≠ N23), S78 (vs. gap), K192 (= K156), A194 (≠ K158), D223 (= D189), N225 (= N191), E249 (= E216), G274 (= G241), E275 (= E242), D298 (≠ G265), H325 (≠ G291), E345 (= E311)
- binding l-glucaric acid: D43 (= D21), K79 (vs. gap), K192 (= K156), D223 (= D189), N225 (= N191), E275 (= E242), H325 (≠ G291), E345 (= E311), F347 (≠ Q313)
- binding magnesium ion: D223 (= D189), E249 (= E216), E275 (= E242)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
29% identity, 84% coverage: 35:357/383 of query aligns to 32:374/376 of 3bjsB
- active site: P49 (≠ E63), S52 (≠ D66), L93 (vs. gap), G136 (≠ S129), K164 (= K156), R166 (≠ K158), D194 (= D189), N196 (= N191), E220 (= E216), G246 (= G241), E247 (= E242), N248 (= N243), Q268 (= Q263), D270 (vs. gap), H297 (vs. gap), S298 (vs. gap), S299 (= S288), E322 (= E311), C324 (vs. gap), K327 (≠ D314)
- binding magnesium ion: D194 (= D189), E220 (= E216), E247 (= E242)
Sites not aligning to the query:
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
38% identity, 54% coverage: 85:289/383 of query aligns to 98:304/372 of 4h19A
- active site: T143 (≠ S129), K172 (= K156), K174 (= K158), D203 (= D189), N205 (= N191), E229 (= E216), G254 (= G241), E255 (= E242), Q276 (= Q263), D278 (vs. gap)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: K172 (= K156), K174 (= K158), D203 (= D189), N205 (= N191), E229 (= E216), E255 (= E242)
- binding calcium ion: D268 (= D255), H298 (≠ R283)
- binding magnesium ion: D203 (= D189), E229 (= E216), E255 (= E242)
Sites not aligning to the query:
- active site: 20, 51, 305, 306, 307, 327
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: 22, 25, 52, 305, 327
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
29% identity, 89% coverage: 26:364/383 of query aligns to 22:384/386 of 3ozmA
- active site: G53 (≠ H52), D56 (= D54), S143 (= S129), K170 (= K156), K172 (= K158), D200 (= D189), N202 (= N191), E226 (= E216), G252 (= G241), E253 (= E242), N254 (= N243), Q274 (= Q263), D276 (≠ G265), H303 (≠ V290), T304 (≠ G291), F305 (≠ Y292), E328 (≠ G309), I331 (≠ V312), H333 (≠ D314)
- binding D-xylaric acid: S24 (= S28), K29 (vs. gap), Y146 (≠ C132), K170 (= K156), K172 (= K158), D200 (= D189), N202 (= N191), E253 (= E242), H303 (≠ V290), F305 (≠ Y292), E328 (≠ G309)
- binding magnesium ion: D200 (= D189), E226 (= E216), E253 (= E242)
Sites not aligning to the query:
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
30% identity, 84% coverage: 26:345/383 of query aligns to 22:365/381 of 3ozmD
- active site: G53 (vs. gap), D56 (= D54), S143 (= S129), K170 (= K156), K172 (= K158), D200 (= D189), N202 (= N191), E226 (= E216), G252 (= G241), E253 (= E242), N254 (= N243), Q274 (= Q263), D276 (≠ G265), H303 (≠ V290), T304 (≠ G291), F305 (≠ Y292), E328 (≠ G309), I331 (≠ V312), H333 (≠ D314)
- binding L-arabinaric acid: K172 (= K158), D200 (= D189), N202 (= N191), E253 (= E242), H303 (≠ V290), F305 (≠ Y292), E328 (≠ G309)
- binding magnesium ion: D200 (= D189), E226 (= E216), E253 (= E242)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
26% identity, 76% coverage: 60:351/383 of query aligns to 54:347/351 of 5olcC
- active site: K148 (= K156), K150 (= K158), D178 (= D189), N180 (= N191), E204 (= E216), G229 (= G241), E230 (= E242), D253 (vs. gap), H280 (≠ V290), E304 (≠ D314), E309 (≠ R319)
- binding magnesium ion: D178 (= D189), E204 (= E216), E230 (= E242)
3n4eA Crystal structure of mandelate racemase/muconate lactonizing protein from paracoccus denitrificans pd1222
30% identity, 81% coverage: 42:353/383 of query aligns to 40:361/368 of 3n4eA
- active site: S124 (= S129), K153 (= K156), R155 (≠ K158), V165 (vs. gap), D190 (= D189), N192 (= N191), E216 (= E216), G241 (= G241), E242 (= E242), Q262 (vs. gap), D264 (= D260), H291 (vs. gap), Q292 (vs. gap), T293 (vs. gap), G296 (vs. gap), P315 (vs. gap), V316 (≠ I310), E317 (= E311), L318 (≠ V312), R324 (≠ A317)
- binding calcium ion: D190 (= D189), E216 (= E216), E242 (= E242), V352 (≠ I344), E354 (= E346)
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
30% identity, 84% coverage: 26:345/383 of query aligns to 22:360/375 of 3op2A
- active site: G53 (vs. gap), D56 (= D54), S138 (= S129), K165 (= K156), K167 (= K158), D195 (= D189), N197 (= N191), E221 (= E216), G247 (= G241), E248 (= E242), N249 (= N243), Q269 (= Q263), D271 (≠ G265), H298 (≠ V290), T299 (≠ G291), F300 (≠ Y292), E323 (≠ G309), I326 (≠ V312), H328 (≠ D314)
- binding 2-oxoglutaric acid: K165 (= K156), K167 (= K158), D195 (= D189), E248 (= E242), H298 (≠ V290), E323 (≠ G309)
- binding magnesium ion: D195 (= D189), E221 (= E216), E248 (= E242)
Sites not aligning to the query:
3toyA Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. Ors278 with calcium and acetate bound
30% identity, 91% coverage: 3:351/383 of query aligns to 5:355/359 of 3toyA
- active site: L21 (≠ V19), A52 (vs. gap), R55 (vs. gap), Q96 (≠ A87), S138 (= S129), K164 (= K156), K166 (= K158), D195 (= D189), N197 (= N191), E221 (= E216), G246 (= G241), E247 (= E242), N248 (= N243), M268 (≠ Q263), D270 (≠ G265), I292 (≠ L285), H297 (≠ G291), I298 (≠ Y292), L299 (≠ N293), H314 (≠ I308), E317 (= E311)
- binding calcium ion: D195 (= D189), E221 (= E216), R236 (≠ S231), S239 (≠ C234), E247 (= E242)
3tteA Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium complexed with magnesium and mandelic acid
30% identity, 91% coverage: 3:351/383 of query aligns to 7:357/361 of 3tteA
- active site: L23 (≠ V19), A54 (vs. gap), R57 (vs. gap), Q98 (≠ A87), S140 (= S129), K166 (= K156), K168 (= K158), D197 (= D189), N199 (= N191), E223 (= E216), G248 (= G241), E249 (= E242), N250 (= N243), M270 (≠ Q263), D272 (≠ G265), I294 (≠ L285), H299 (≠ G291), I300 (≠ Y292), L301 (≠ N293), H316 (≠ I308), E319 (= E311)
- binding magnesium ion: D197 (= D189), E223 (= E216), E249 (= E242)
- binding (s)-mandelic acid: K166 (= K156), D197 (= D189), N199 (= N191), E223 (= E216), E249 (= E242), H299 (≠ G291), E319 (= E311)
3ugvF Crystal structure of an enolase from alpha pretobacterium bal199 (efi target efi-501650) with bound mg
30% identity, 74% coverage: 67:350/383 of query aligns to 75:359/364 of 3ugvF
- active site: A95 (= A87), S137 (= S129), K168 (= K156), R170 (≠ K158), D199 (= D189), N201 (= N191), E225 (= E216), G250 (= G241), E251 (= E242), N252 (= N243), M272 (≠ Q263), D274 (≠ G265), A293 (= A282), H301 (≠ V290), L302 (≠ G291), Y303 (= Y292), E321 (= E311)
- binding magnesium ion: D199 (= D189), E225 (= E216), R240 (≠ S231), L243 (≠ C234), E251 (= E242)
Sites not aligning to the query:
3u4fA Crystal structure of a mandelate racemase (muconate lactonizing enzyme family protein) from roseovarius nubinhibens
32% identity, 68% coverage: 93:353/383 of query aligns to 86:365/371 of 3u4fA
- active site: S122 (= S129), K150 (= K156), R152 (≠ K158), D162 (vs. gap), D188 (= D189), N190 (= N191), F213 (≠ I215), E214 (= E216), D235 (≠ A237), G239 (= G241), E240 (= E242), Q261 (= Q263), D263 (≠ G265), H290 (≠ V290), A292 (≠ Y292), N293 (= N293), K313 (vs. gap), E316 (vs. gap), I319 (= I310), G321 (≠ V312)
- binding magnesium ion: D188 (= D189), E214 (= E216), S229 (= S231), L232 (≠ C234), E240 (= E242)
Sites not aligning to the query:
2qq6B Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from rubrobacter xylanophilus dsm 9941
27% identity, 74% coverage: 64:348/383 of query aligns to 57:382/396 of 2qq6B
- active site: G79 (= G85), D124 (≠ S129), K166 (= K156), D168 (≠ K158), D213 (= D189), H215 (≠ N191), E239 (= E216), G264 (= G241), E265 (= E242), M286 (≠ Q263), D288 (vs. gap), H315 (vs. gap), N316 (vs. gap), E340 (vs. gap), D345 (≠ E311)
- binding magnesium ion: D213 (= D189), E239 (= E216), E265 (= E242), H315 (vs. gap)
Sites not aligning to the query:
Query Sequence
>Ga0059261_2661 FitnessBrowser__Korea:Ga0059261_2661
MKITGYRSLTTTHDWGRPVGDVNGVVESGVTEVPILLLETDGGLTGIGLGQHVDIARVFP
AVEGQDPRAVTALYDSMLAHVFKSGHAGATYGAIAAIDMALWDLKAKMADEPLWRTLGAL
DRFVPGYASGLCYGLPDDAFAAHYRDWASRGFSSAKIKGGRDTARDIGRLLTARDILSVN
TSRPAMMLDVNEAWNVKQAVRHLAEIEAQLDLTWIEEPVRRWDAEGHARISRACRAAVAT
GENLTGLDQFTPLFDARAVDVVQTGSVWGITHFLRVATAAHARNLPVSPVGYNANPVAHA
AAAMPNMIGIEVQDWNAPRGLKVDQVVTDGGIRLGDAPGLGIEIDEAALANGAAPGWNSS
GGPHRRPRHAGLRLVPDGPQAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory