SitesBLAST
Comparing Ga0059261_2665 FitnessBrowser__Korea:Ga0059261_2665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 97% coverage: 4:244/248 of query aligns to 6:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), Q15 (≠ G13), G16 (= G14), I17 (≠ L15), D36 (= D34), V63 (≠ L62), N89 (= N88), A91 (= A90), S94 (≠ P93), I142 (≠ V138), S143 (= S139), S144 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), H188 (≠ G184), I190 (≠ F186), I194 (≠ A190)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 100% coverage: 1:247/248 of query aligns to 5:244/244 of 4nbuB
- active site: G18 (= G14), N111 (= N112), S139 (= S140), Q149 (≠ L150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ S94), K98 (≠ D99), S139 (= S140), N146 (≠ W147), V147 (≠ A148), Q149 (≠ L150), Y152 (= Y153), F184 (≠ A185), M189 (≠ K192), K200 (≠ M203)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), N17 (≠ G13), G18 (= G14), I19 (≠ L15), D38 (= D34), F39 (vs. gap), V59 (≠ T59), D60 (= D61), V61 (≠ L62), N87 (= N88), A88 (= A89), G89 (≠ A90), I90 (= I91), T137 (≠ V138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), F184 (≠ A185), T185 (= T188), T187 (≠ A190), M189 (≠ K192)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 100% coverage: 1:247/248 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ A12), R18 (≠ G13), I20 (≠ L15), T40 (≠ H35), N62 (≠ D61), V63 (≠ L62), N89 (= N88), A90 (= A89), I92 (= I91), V139 (= V138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), I187 (≠ F186), T189 (= T188), M191 (≠ A190)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
36% identity, 100% coverage: 1:247/248 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M16 (≠ L15), D35 (= D34), I36 (≠ H35), I62 (≠ L62), N88 (= N88), G90 (≠ A90), I138 (≠ V138), S140 (= S140), Y152 (= Y153), K156 (= K157), I185 (≠ F186)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
36% identity, 100% coverage: 1:247/248 of query aligns to 3:245/248 of Q9KJF1
- S15 (≠ G13) binding
- D36 (= D34) binding
- D62 (= D61) binding
- I63 (≠ L62) binding
- N89 (= N88) binding
- Y153 (= Y153) binding
- K157 (= K157) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
33% identity, 99% coverage: 2:247/248 of query aligns to 3:242/243 of 7emgB
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 98% coverage: 4:247/248 of query aligns to 5:246/246 of 3osuA
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
37% identity, 98% coverage: 1:244/248 of query aligns to 4:237/241 of 5t2uA
- active site: G17 (= G14), T135 (≠ S140), T145 (≠ L150), Y148 (= Y153), K152 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), G17 (= G14), R38 (≠ H35), D39 (= D36), R42 (≠ K39), D60 (= D61), L61 (= L62), N83 (= N88), A84 (= A89), Y87 (= Y92), I133 (≠ V138), T135 (≠ S140), Y148 (= Y153), K152 (= K157), P178 (= P183), P180 (≠ A185), T181 (vs. gap), T183 (≠ F186), T185 (= T188), T186 (≠ D189)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 98% coverage: 4:247/248 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G14), S138 (= S140), Q148 (≠ L150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (≠ A12), R11 (≠ G13), I13 (≠ L15), N31 (≠ D34), Y32 (≠ H35), A33 (vs. gap), G34 (vs. gap), S35 (≠ D36), A58 (= A60), N59 (≠ D61), V60 (≠ L62), N86 (= N88), A87 (= A89), T109 (≠ V111), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 100% coverage: 1:248/248 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G14), S143 (= S140), I154 (≠ L150), Y157 (= Y153), K161 (= K157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), R16 (≠ G13), G17 (= G14), L18 (= L15), S37 (≠ D34), R38 (≠ H35), C63 (≠ A60), D64 (= D61), V65 (≠ L62), A91 (≠ N88), A92 (= A89), G93 (≠ A90), I94 (= I91), V114 (= V111), I141 (≠ V138), S143 (= S140), Y157 (= Y153), K161 (= K157), P187 (= P183), G188 (= G184), Y190 (≠ F186), T192 (= T188), M194 (vs. gap), T195 (≠ A190)
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
33% identity, 98% coverage: 1:244/248 of query aligns to 3:243/247 of 2ewmB
- active site: G16 (= G14), S139 (= S140), Y149 (≠ L150), Y152 (= Y153), K156 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), N15 (≠ G13), G16 (= G14), I17 (≠ L15), D36 (= D36), L37 (= L37), C59 (≠ A60), D60 (= D61), V61 (≠ L62), N87 (= N88), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P183), S183 (≠ G184), L184 (≠ A185), V185 (≠ F186), T189 (≠ A190)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
34% identity, 100% coverage: 1:247/248 of query aligns to 6:242/243 of 4i08A
- active site: G19 (= G14), N113 (= N112), S141 (= S140), Q151 (≠ L150), Y154 (= Y153), K158 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G10), S17 (≠ A12), R18 (≠ G13), I20 (≠ L15), T40 (≠ H35), N62 (≠ D61), V63 (≠ L62), N89 (= N88), A90 (= A89), G140 (≠ S139), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), T189 (= T188)
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
33% identity, 98% coverage: 1:244/248 of query aligns to 5:245/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3rwbA Crystal structure of complex of 4pal (4-pyridoxolactone) and pldh (tetrameric pyridoxal 4-dehydrogenase) from mesorhizobium loti
35% identity, 98% coverage: 3:244/248 of query aligns to 6:243/247 of 3rwbA
- active site: G17 (= G14), S140 (= S140), Y153 (= Y153), K157 (= K157)
- binding 7-hydroxy-6-methylfuro[3,4-c]pyridin-1(3H)-one: S140 (= S140), N141 (≠ I141), T142 (= T142), M150 (≠ L150), Y153 (= Y153), L185 (≠ A185), H196 (≠ D196)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), Q16 (≠ G13), G17 (= G14), I18 (≠ L15), D37 (= D34), I38 (≠ H35), D60 (= D61), I61 (≠ L62), N87 (= N88), A88 (= A89), S89 (≠ A90), I138 (≠ V138), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), L185 (≠ A185), I186 (≠ F186), S188 (≠ T188), G190 (≠ A190), V191 (≠ E191)
3ndrA Crystal structure of tetrameric pyridoxal 4-dehydrogenase from mesorhizobium loti
35% identity, 98% coverage: 3:244/248 of query aligns to 6:243/247 of 3ndrA
- active site: G17 (= G14), S140 (= S140), Y153 (= Y153), K157 (= K157)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), Q16 (≠ G13), G17 (= G14), I18 (≠ L15), D37 (= D34), I38 (≠ H35), D60 (= D61), I61 (≠ L62), N87 (= N88), A88 (= A89), S89 (≠ A90), V110 (= V111), I138 (≠ V138), S140 (= S140), Y153 (= Y153), K157 (= K157), P183 (= P183), L185 (≠ A185), I186 (≠ F186), S188 (≠ T188), G190 (≠ A190), V191 (≠ E191)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
33% identity, 100% coverage: 1:248/248 of query aligns to 3:244/244 of 7krmC
- active site: G18 (= G14), S140 (= S140), Y155 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S15 (≠ G13), G18 (= G14), I19 (≠ L15), D38 (= D34), L39 (≠ H35), A60 (= A60), N61 (≠ D61), V62 (≠ L62), N88 (= N88), V111 (= V111), S140 (= S140), Y155 (= Y153), K159 (= K157), I188 (≠ F186), T190 (= T188)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
33% identity, 99% coverage: 1:246/248 of query aligns to 2:258/260 of 2ztlA
- active site: G15 (= G14), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157), L200 (vs. gap)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ Y92), S142 (= S140), H144 (≠ T142), K152 (≠ L150), Y155 (= Y153), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), G15 (= G14), I16 (≠ L15), F36 (≠ H35), L64 (= L62), N90 (= N88), A91 (= A89), G92 (≠ A90), L113 (≠ V111), Y155 (= Y153), K159 (= K157), P185 (= P183), W187 (≠ A185), V188 (≠ F186), T190 (= T188), V193 (vs. gap)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
33% identity, 99% coverage: 1:246/248 of query aligns to 2:258/260 of 1wmbA
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
33% identity, 99% coverage: 2:247/248 of query aligns to 4:243/244 of 6t77A
- active site: G16 (= G14), S138 (= S140), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ G13), T37 (≠ H35), L58 (≠ V57), N59 (≠ S58), V60 (≠ T59), A87 (= A89), G88 (≠ A90), I89 (= I91)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 99% coverage: 2:247/248 of query aligns to 4:243/244 of P0A2C9
- M125 (= M127) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A227) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S228) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
Query Sequence
>Ga0059261_2665 FitnessBrowser__Korea:Ga0059261_2665
VKGRTVLYTGAAGGLGLDTTLLLIERGATVVAIDHDLAKVEALEAAARGKGPGRLIVSTA
DLADLDRLRVTLDILIEETGGFDVVINNAAIYPSKPFEDYSIAEHQAIQRVNVDAGIVAV
QAALPGMQAKGFGRIINVSSITISGGWANLSPYVASKMALVGLTRAWAREFGAWGVTVNA
IAPGAFPTDAEKIHPDPEGYNRMVLDAQSIKRRGTARDIANAIAFFASDESGFVTGQTLH
VNGGWTMN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory