SitesBLAST
Comparing Ga0059261_2675 FitnessBrowser__Korea:Ga0059261_2675 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
59% identity, 99% coverage: 1:240/242 of query aligns to 1:243/245 of D4A1J4
- Y147 (= Y144) mutation to F: Loss of function.
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
57% identity, 99% coverage: 1:240/242 of query aligns to 1:243/245 of Q8JZV9
- Y147 (= Y144) active site, Proton acceptor; mutation to F: Loss of function.
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
57% identity, 99% coverage: 1:240/242 of query aligns to 1:243/245 of Q9BUT1
2ag5A Crystal structure of human dhrs6 (see paper)
57% identity, 99% coverage: 1:240/242 of query aligns to 1:243/246 of 2ag5A
- active site: S133 (= S130), Y147 (= Y144), K151 (= K148), R192 (≠ T189)
- binding nicotinamide-adenine-dinucleotide: Q16 (= Q16), G17 (= G17), I18 (= I18), D37 (= D37), I38 (≠ V38), D58 (= D55), V59 (= V56), V81 (≠ C78), G83 (= G80), L104 (= L101), Y147 (= Y144), K151 (= K148), P177 (= P174), V180 (= V177), T182 (= T179), S184 (= S181)
- binding sulfate ion: R144 (= R141), R188 (= R185), F202 (= F199), R205 (= R202)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
37% identity, 98% coverage: 4:239/242 of query aligns to 5:244/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
37% identity, 98% coverage: 4:239/242 of query aligns to 5:244/255 of 2dteA
- active site: G18 (= G17), S132 (= S130), Y145 (= Y144), S148 (≠ T147), K149 (= K148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A13), S16 (≠ G15), M17 (≠ Q16), G18 (= G17), I19 (= I18), S38 (≠ D37), I39 (≠ V38), C52 (≠ L54), D53 (= D55), V54 (= V56), N80 (≠ C78), A81 (= A79), I130 (≠ M128), S132 (= S130), Y145 (= Y144), K149 (= K148), P174 (= P174), A175 (≠ G175), T176 (= T176), I177 (≠ V177), T179 (= T179), P180 (= P180), L181 (= L182), V182 (≠ I183)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 98% coverage: 3:239/242 of query aligns to 7:249/258 of 4wecA
- active site: G21 (= G17), S143 (= S130), Q154 (≠ R141), Y157 (= Y144), K161 (= K148)
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A13), A19 (≠ G15), S20 (≠ Q16), G21 (= G17), I22 (= I18), D41 (= D37), I42 (≠ V38), V61 (≠ L54), D62 (= D55), V63 (= V56), N89 (≠ C78), T141 (≠ M128), Y157 (= Y144), K161 (= K148), P187 (= P174), P189 (≠ T176), V190 (= V177)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
34% identity, 99% coverage: 2:240/242 of query aligns to 1:245/248 of 6ixmC
- active site: G16 (= G17), S142 (= S130), Y155 (= Y144), K159 (= K148)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A13), S15 (≠ Q16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ V38), A61 (≠ L54), D62 (= D55), T63 (≠ V56), N89 (≠ C78), A90 (= A79), M140 (= M128), S142 (= S130), Y155 (= Y144), K159 (= K148), P185 (= P174), A186 (≠ G175), Y187 (≠ T176), I188 (≠ V177), L192 (= L182)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
37% identity, 97% coverage: 7:240/242 of query aligns to 3:247/250 of 2cfcA
- active site: G13 (= G17), S142 (= S130), Y155 (= Y144), K159 (= K148)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ V138), R152 (= R141), Y155 (= Y144), W195 (≠ Q184), R196 (= R185)
- binding nicotinamide-adenine-dinucleotide: G9 (≠ A13), S12 (≠ Q16), G13 (= G17), N14 (≠ I18), D33 (= D37), L34 (≠ V38), A59 (≠ L54), D60 (= D55), V61 (= V56), N87 (≠ C78), A88 (= A79), G89 (= G80), I140 (≠ M128), P185 (= P174), G186 (= G175), M187 (≠ T176), I188 (≠ V177), T190 (= T179), P191 (= P180), M192 (≠ S181), T193 (≠ L182)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
37% identity, 97% coverage: 7:240/242 of query aligns to 3:247/250 of Q56840
- SGN 12:14 (≠ QGI 16:18) binding
- D33 (= D37) binding
- DV 60:61 (= DV 55:56) binding
- N87 (≠ C78) binding
- S142 (= S130) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R141) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y144) mutation Y->E,F: Loss of activity.
- K159 (= K148) mutation to A: Loss of activity.
- R179 (= R168) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VETPS 177:181) binding
- WR 195:196 (≠ QR 184:185) binding
- R196 (= R185) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ Y196) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R202) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5jc8D Crystal structure of a putative short-chain dehydrogenase/reductase from burkholderia xenovorans
36% identity, 98% coverage: 2:239/242 of query aligns to 2:256/262 of 5jc8D
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 99% coverage: 2:241/242 of query aligns to 2:238/244 of 1nfqA
- active site: G17 (= G17), S139 (= S130), Y152 (= Y144), K156 (= K148)
- binding Androsterone: L91 (≠ V82), E141 (≠ S133), C149 (≠ R141), Y152 (= Y144), V193 (≠ Y196), I197 (≠ T200), F198 (≠ A201)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ Q16), G17 (= G17), M18 (≠ I18), D37 (= D37), L39 (≠ R39), L59 (= L54), D60 (= D55), V61 (= V56), N87 (≠ C78), A88 (= A79), I137 (≠ M128), S139 (= S130), Y152 (= Y144), K156 (= K148), P182 (= P174), V185 (= V177), T187 (= T179), P188 (= P180), M189 (≠ F192), T190 (≠ E193)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
39% identity, 99% coverage: 2:241/242 of query aligns to 2:238/244 of 1nffA
- active site: G17 (= G17), S139 (= S130), Y152 (= Y144), K156 (= K148)
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A13), R16 (≠ Q16), G17 (= G17), M18 (≠ I18), D37 (= D37), I38 (≠ V38), L39 (≠ R39), L59 (= L54), D60 (= D55), V61 (= V56), N87 (≠ C78), A88 (= A79), G89 (= G80), I90 (≠ F81), I137 (≠ M128), S139 (= S130), Y152 (= Y144), K156 (= K148), P182 (= P174), V185 (= V177), T187 (= T179), P188 (= P180), M189 (≠ F192), T190 (≠ E193)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 98% coverage: 3:240/242 of query aligns to 4:252/255 of 5itvA
- active site: G18 (= G17), S141 (= S130), Y154 (= Y144), K158 (= K148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A13), S17 (≠ Q16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (vs. gap), T61 (= T51), I63 (≠ Q53), N89 (≠ C78), G91 (= G80), T139 (≠ M128), S141 (= S130), Y154 (= Y144), K158 (= K148), P184 (= P174), G185 (= G175), I186 (≠ T176), I187 (≠ V177)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 99% coverage: 1:239/242 of query aligns to 2:241/244 of 4nbuB
- active site: G18 (= G17), N111 (= N102), S139 (= S130), Q149 (≠ R141), Y152 (= Y144), K156 (= K148)
- binding acetoacetyl-coenzyme a: D93 (≠ A84), K98 (≠ D89), S139 (= S130), N146 (≠ A137), V147 (= V138), Q149 (≠ R141), Y152 (= Y144), F184 (≠ T176), M189 (≠ S181), K200 (≠ E198)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (≠ A13), N17 (≠ Q16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ V38), V59 (≠ L54), D60 (= D55), V61 (= V56), N87 (≠ C78), A88 (= A79), G89 (= G80), I90 (≠ F81), T137 (≠ M128), S139 (= S130), Y152 (= Y144), K156 (= K148), P182 (= P174), F184 (≠ T176), T185 (≠ V177), T187 (= T179), M189 (≠ S181)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
38% identity, 98% coverage: 4:239/242 of query aligns to 3:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A13), G16 (= G17), I17 (= I18), D36 (= D37), L37 (≠ V38), C61 (≠ L54), D62 (= D55), V63 (= V56), N89 (≠ C78), A90 (= A79), T140 (≠ M128), S142 (= S130), Y155 (= Y144), K159 (= K148), A186 (≠ G175), V187 (≠ T176)
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
35% identity, 98% coverage: 3:239/242 of query aligns to 7:255/260 of 5ojiA
- active site: G21 (= G17), S148 (≠ V131), Y161 (= Y144), K165 (= K148)
- binding isatin: S148 (≠ V131), S150 (= S133), Y161 (= Y144), V193 (≠ T176), S199 (≠ I183), L202 (= L186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (= A13), T19 (≠ G15), I22 (= I18), S41 (≠ D37), R42 (≠ V38), N43 (≠ R39), N46 (≠ A42), I69 (vs. gap), N95 (≠ C78), H96 (≠ A79), G97 (= G80), N146 (≠ S129), S148 (≠ V131), Y161 (= Y144), K165 (= K148), G192 (= G175), I194 (≠ V177), T196 (= T179), M198 (≠ L182)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
35% identity, 98% coverage: 3:239/242 of query aligns to 7:255/260 of 5ojgA
- active site: G21 (= G17), S148 (≠ V131), Y161 (= Y144), K165 (= K148)
- binding butane-2,3-dione: S148 (≠ V131), Y161 (= Y144)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (= A13), T19 (≠ G15), G21 (= G17), I22 (= I18), S41 (≠ D37), R42 (≠ V38), N43 (≠ R39), N46 (≠ A42), I69 (vs. gap), N95 (≠ C78), H96 (≠ A79), G97 (= G80), N146 (≠ S129), S148 (≠ V131), Y161 (= Y144), K165 (= K148), P191 (= P174), I194 (≠ V177), T196 (= T179), M198 (≠ L182)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
35% identity, 98% coverage: 4:239/242 of query aligns to 2:239/243 of 7emgB
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 98% coverage: 2:239/242 of query aligns to 3:237/260 of P9WGT1
- I6 (≠ E5) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ QGI 16:18) binding
- D38 (= D37) binding
- V47 (≠ T51) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (= DV 55:56) binding
- T69 (vs. gap) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (≠ C78) binding
- S140 (= S130) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y144) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K148) binding
- 183:191 (vs. 174:193, 25% identical) binding
Query Sequence
>Ga0059261_2675 FitnessBrowser__Korea:Ga0059261_2675
MGRLEGKIALVTAAGQGIGRATVEAFVREGARVIATDVRAEALDGLEGAETRQLDVTSKD
AVAAIAAEFPELNVLYNCAGFVHAGTILDCDEDAWEFSQSLNVTAQYRMIRAVLPHMIAR
GGGSIINMSSVCSSIKAVPNRFAYGATKAAVIGLTKSVAIDYVTKGIRCNAICPGTVETP
SLIQRLHDTGDFEKAYAEFTARQAMGRFGRTSELAALAVYLASDESAFTTGTVNVIDGGW
VN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory