Comparing Ga0059261_2677 FitnessBrowser__Korea:Ga0059261_2677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
29% identity, 90% coverage: 7:307/336 of query aligns to 13:279/315 of 7svqA
7ezlA Rice l-galactose dehydrogenase (holo form)
29% identity, 89% coverage: 11:308/336 of query aligns to 18:281/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
29% identity, 89% coverage: 11:308/336 of query aligns to 23:286/323 of 7eziA
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
25% identity, 93% coverage: 11:321/336 of query aligns to 16:300/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
25% identity, 93% coverage: 11:321/336 of query aligns to 15:299/311 of 1pz0A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
29% identity, 88% coverage: 7:303/336 of query aligns to 13:264/298 of 1ynqB
Sites not aligning to the query:
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
29% identity, 88% coverage: 7:303/336 of query aligns to 13:264/298 of 1ynpB
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
26% identity, 90% coverage: 8:308/336 of query aligns to 18:303/326 of P77256
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
28% identity, 88% coverage: 7:303/336 of query aligns to 13:249/283 of 1ynpA
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 90% coverage: 8:308/336 of query aligns to 24:324/351 of Q9P7U2
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
26% identity, 95% coverage: 8:325/336 of query aligns to 13:308/337 of Q3L181
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
27% identity, 88% coverage: 7:303/336 of query aligns to 5:269/301 of 6ow0B
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
27% identity, 88% coverage: 7:303/336 of query aligns to 5:293/323 of 6ow0A
Sites not aligning to the query:
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
25% identity, 95% coverage: 7:325/336 of query aligns to 12:276/287 of 3v0sA
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
27% identity, 82% coverage: 8:282/336 of query aligns to 28:259/259 of 4exaF
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
24% identity, 73% coverage: 8:252/336 of query aligns to 18:222/331 of P80874
Sites not aligning to the query:
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
24% identity, 73% coverage: 8:252/336 of query aligns to 18:222/333 of 1pz1A
Sites not aligning to the query:
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
25% identity, 90% coverage: 7:308/336 of query aligns to 24:271/286 of 8hnqA
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
24% identity, 87% coverage: 27:317/336 of query aligns to 41:311/335 of 4aubB
Sites not aligning to the query:
3n6qD Crystal structure of yghz from e. Coli (see paper)
24% identity, 87% coverage: 27:317/336 of query aligns to 42:298/315 of 3n6qD
Sites not aligning to the query:
>Ga0059261_2677 FitnessBrowser__Korea:Ga0059261_2677
MMERLTNLGQLAFGAASIGNLYRAVPEAQARDVVARAWDAGVRTFDTAPHYGFGLSEKRL
GAALAELDPAQSAIVSTKIGRRLDPRPDADLSAMRQAFVSPEPYESVFDYSYDAVMRSYE
GSLKRLRRDRIDILYAHDIGVFAHGAAHPRRFAEFMGGGYRAMLKLRDSGAVGAIGIGVN
EVAVCIEMLGAGEIDLIMLAGRYTLLEQDPLDDLLPLCARRGVRLVIAGPYNSGILAKGV
RHGGAIPNFNYEPAPPAILERVGAIEDVCAKHGVPLAAAALQFPLAHPQVASVVPGMGSV
RQVDDALALMARVIPVTLWEELRDAGLIRRDAPLPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory