Comparing Ga0059261_2720 FitnessBrowser__Korea:Ga0059261_2720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 38% coverage: 10:221/558 of query aligns to 36:256/583 of Q9Y7Q9
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 41% coverage: 7:232/558 of query aligns to 36:244/444 of Q8NLB7
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 56% coverage: 10:322/558 of query aligns to 40:423/559 of Q09852
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 40% coverage: 10:231/558 of query aligns to 42:280/572 of O42885
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 27% coverage: 67:219/558 of query aligns to 187:325/616 of P36035
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 37% coverage: 9:217/558 of query aligns to 59:277/587 of P25297
Sites not aligning to the query:
8fvzA Pipt y150a
24% identity, 55% coverage: 14:320/558 of query aligns to 4:313/433 of 8fvzA
Sites not aligning to the query:
>Ga0059261_2720 FitnessBrowser__Korea:Ga0059261_2720
MTAQPAVAGRNERKVIIASSLGTVFEWYDFYLYGLLATVISAKFFSGVNETTAFILALGA
FAAGFAVRPFGALVFGRLGDVVGRKYTFLVTMGLMGLSTFAVGILPSYASIGVAAPIILV
ALRLVQGLALGGEYGGAATYVAEHAPEGKRGLFTSWIQTTATLGLFAALLVVIGIRTAIG
EAAFADWGWRLPFLVSILLLAVSLWIRLQLAESPVFQKMKEEGTTSKAPFTEAFGQWRNL
RTVLIVLLGAVAGQAVVWYTGQFYALFFLEKTLKVDGATANILIAIALALATPFFVIFGA
LSDRIGRKKIILTGCALAAISYFPTFHALTQAANPALAAAQRQAPVTIMSSNDICSVQFD
PIGGNKFDQSGCDIAKAYLAKSGIPYKSVPATLPPGAPTLKFTTVRVGEEDHPAPDPVGI
APAERAAVIAAYQAELKTALTRAGYPAKADPAAMNKPLIVALLFWLVLLVTAVYGPIAAL
LVEIFPTRIRYTAMSLPYHIGNGWFGGFLPTIAFAMVAATGDIYYGLWYPIIVAVLTLIL
GLLFLPETFRRRIDESAT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory