Comparing Ga0059261_2767 FitnessBrowser__Korea:Ga0059261_2767 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P0AAC6 Modulator of FtsH protease YccA from Escherichia coli (strain K12) (see 2 papers)
31% identity, 88% coverage: 30:248/248 of query aligns to 11:219/219 of P0AAC6
Sites not aligning to the query:
>Ga0059261_2767 FitnessBrowser__Korea:Ga0059261_2767
MANWSDPHTTAAPYATAAGTRDAAYDAGLRSYMLSVYNYMASGVLLSGVVALLFAWGGET
SMAYSVFANGGPLAWLIILSPLAIVFAMSFGQNKMSTGTLQALFWGFAVLMGLSLSTLLL
RYTGASVAQAFFATAAGFAGLSLYGYTTKRDLSGLGSFLIVGLIGLIVASIINIFTQSST
LSLIISFAGVLIFAGLTAYDTQRIKSMYAYVAGTDMVGKVVIMSALSLYLDFINMFQFLL
SIIGSSRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory