Comparing Ga0059261_2769 FitnessBrowser__Korea:Ga0059261_2769 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
37% identity, 90% coverage: 37:431/437 of query aligns to 22:393/398 of 6slfA
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
36% identity, 82% coverage: 34:393/437 of query aligns to 10:349/380 of P54955
Sites not aligning to the query:
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 78% coverage: 34:376/437 of query aligns to 48:377/440 of O04373
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
32% identity, 92% coverage: 34:436/437 of query aligns to 16:389/389 of 4ewtA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 92% coverage: 34:433/437 of query aligns to 52:428/442 of P54968
>Ga0059261_2769 FitnessBrowser__Korea:Ga0059261_2769
MKHLLIAAASSLAFALPAAADPIRDATAKELPSLMALYKELHAAPELSQHEVQTAARMAA
EARKAGFTVTEKVGGTGVVAVMKNGAGPTILIRADMDGLPVTEETGLPFASKVRGKTPEG
VETGIMHACAHDTHMTAWVGTLRNLAAMKGKWKGTLVMVAQPAEENSAGAIAMLNDGLYA
RFGKPSHAIAFHNSAALPAGTIGIRSGPTFASVDSVDIVVKGVGGHGAYPATTKDPIVLG
ARIVSALQTIVAREVDPLDSAVITVGSFQGGTRHNIIPEQALLLLTVRAYTPEVRKQLLD
GIARIAKGEAIAAGVPEERMPVVTIRENFTPPTVSTDPFATHLKTLFTARFGKDRVTDIA
PTMAGEDFGRYHIADPSIQSAIYWVGGVPQDKWDAAKASGGKGLPSLHSSKWAPDAEKVI
GTAAEAMTAAALDLLQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory