SitesBLAST
Comparing Ga0059261_2803 FitnessBrowser__Korea:Ga0059261_2803 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
38% identity, 99% coverage: 3:266/266 of query aligns to 3:257/257 of 6slbAAA
- active site: Q64 (≠ G65), F69 (≠ M70), L80 (≠ I84), N84 (≠ Q93), A108 (= A117), S111 (≠ D120), A130 (≠ S139), F131 (= F140), L136 (= L145), P138 (≠ S147), D139 (≠ A148), A224 (≠ E233), G234 (≠ Q243)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ D59), A62 (= A63), Q64 (≠ G65), D65 (≠ N66), L66 (≠ I67), Y76 (≠ F77), A108 (= A117), F131 (= F140), D139 (≠ A148)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
38% identity, 98% coverage: 5:266/266 of query aligns to 2:245/245 of 6slaAAA
- active site: Q61 (≠ G65), L68 (≠ I84), N72 (≠ Y88), A96 (= A117), S99 (≠ D120), A118 (≠ S139), F119 (= F140), L124 (= L145), P126 (≠ S147), N127 (≠ A148), A212 (≠ E233), G222 (≠ Q243)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R25), A59 (= A63), Q61 (≠ G65), D62 (≠ N66), L63 (≠ I67), L68 (≠ I84), Y71 (≠ T87), A94 (≠ M115), G95 (= G116), A96 (= A117), F119 (= F140), I122 (≠ L143), L124 (= L145), N127 (≠ A148), F234 (≠ A255), K237 (= K258)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
34% identity, 100% coverage: 1:266/266 of query aligns to 1:259/259 of 5zaiC
- active site: A65 (≠ G65), F70 (≠ M70), S82 (≠ A78), R86 (≠ A82), G110 (≠ A117), E113 (≠ D120), P132 (≠ S139), E133 (≠ F140), I138 (≠ L145), P140 (≠ S147), G141 (≠ A148), A226 (≠ E233), F236 (≠ Q243)
- binding coenzyme a: K24 (≠ T24), L25 (≠ R25), A63 (= A63), G64 (= G64), A65 (≠ G65), D66 (≠ N66), I67 (= I67), P132 (≠ S139), R166 (≠ T173), F248 (≠ A255), K251 (= K258)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
37% identity, 96% coverage: 9:263/266 of query aligns to 8:249/250 of 3q0gD
- active site: A64 (≠ G65), M69 (= M70), T75 (≠ R73), F79 (= F77), G103 (≠ A117), E106 (≠ D120), P125 (≠ S139), E126 (≠ F140), V131 (≠ L145), P133 (≠ S147), G134 (≠ A148), L219 (≠ E233), F229 (≠ Q243)
- binding Butyryl Coenzyme A: F225 (≠ Q239), F241 (≠ A255)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
35% identity, 99% coverage: 1:263/266 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (≠ G65), M70 (= M70), T80 (≠ A78), F84 (≠ R85), G108 (≠ A117), E111 (≠ D120), P130 (≠ S139), E131 (≠ F140), V136 (≠ L145), P138 (≠ S147), G139 (≠ A148), L224 (≠ E233), F234 (≠ Q243)
- binding acetoacetyl-coenzyme a: Q23 (≠ A23), A24 (≠ T24), L25 (≠ R25), A27 (= A27), A63 (= A63), G64 (= G64), A65 (≠ G65), D66 (≠ N66), I67 (= I67), K68 (= K68), M70 (= M70), F84 (≠ R85), G107 (= G116), G108 (≠ A117), E111 (≠ D120), P130 (≠ S139), E131 (≠ F140), P138 (≠ S147), G139 (≠ A148), M140 (≠ A149)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
35% identity, 99% coverage: 1:263/266 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (≠ G65), M70 (= M70), T80 (≠ A78), F84 (≠ R85), G108 (≠ A117), E111 (≠ D120), P130 (≠ S139), E131 (≠ F140), V136 (≠ L145), P138 (≠ S147), G139 (≠ A148), L224 (≠ E233), F234 (≠ Q243)
- binding coenzyme a: L25 (≠ R25), A63 (= A63), I67 (= I67), K68 (= K68), Y104 (≠ A113), P130 (≠ S139), E131 (≠ F140), L134 (= L143)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
36% identity, 96% coverage: 9:263/266 of query aligns to 8:253/256 of 3h81A
- active site: A64 (≠ G65), M69 (= M70), T79 (≠ A78), F83 (≠ R85), G107 (≠ A117), E110 (≠ D120), P129 (≠ S139), E130 (≠ F140), V135 (≠ L145), P137 (≠ S147), G138 (≠ A148), L223 (≠ E233), F233 (≠ Q243)
- binding calcium ion: F233 (≠ Q243), Q238 (= Q248)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
33% identity, 99% coverage: 4:266/266 of query aligns to 5:261/261 of 5jbxB
- active site: A67 (≠ G65), R72 (≠ M70), L84 (≠ Q89), R88 (≠ Q93), G112 (≠ A117), E115 (≠ D120), T134 (≠ S139), E135 (≠ F140), I140 (≠ L145), P142 (≠ S147), G143 (≠ A148), A228 (≠ E233), L238 (≠ Q243)
- binding coenzyme a: S24 (≠ A23), R25 (≠ T24), R26 (= R25), A28 (= A27), A65 (= A63), D68 (≠ N66), L69 (≠ I67), K70 (= K68), L110 (≠ M115), G111 (= G116), T134 (≠ S139), E135 (≠ F140), L138 (= L143), R168 (≠ T173)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 100% coverage: 2:266/266 of query aligns to 6:266/266 of O53561
- K135 (= K135) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 135:142, 50% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (= K142) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 97% coverage: 7:264/266 of query aligns to 10:258/260 of 1dubA
- active site: A68 (≠ G65), M73 (= M70), S83 (≠ Q89), L87 (≠ Q93), G111 (≠ A117), E114 (≠ D120), P133 (≠ S139), E134 (≠ F140), T139 (≠ L145), P141 (≠ S147), G142 (≠ A148), K227 (≠ E233), F237 (≠ Q243)
- binding acetoacetyl-coenzyme a: K26 (≠ A23), A27 (≠ T24), L28 (≠ R25), A30 (= A27), A66 (= A63), A68 (≠ G65), D69 (≠ N66), I70 (= I67), Y107 (≠ A113), G110 (= G116), G111 (≠ A117), E114 (≠ D120), P133 (≠ S139), E134 (≠ F140), L137 (= L143), G142 (≠ A148), F233 (≠ Q239), F249 (≠ A255)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 97% coverage: 7:264/266 of query aligns to 8:256/258 of 1ey3A
- active site: A66 (≠ G65), M71 (= M70), S81 (≠ Q89), L85 (≠ Q93), G109 (≠ A117), E112 (≠ D120), P131 (≠ S139), E132 (≠ F140), T137 (≠ L145), P139 (≠ S147), G140 (≠ A148), K225 (≠ E233), F235 (≠ Q243)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ A23), L26 (≠ R25), A28 (= A27), A64 (= A63), G65 (= G64), A66 (≠ G65), D67 (≠ N66), I68 (= I67), L85 (≠ Q93), W88 (≠ A96), G109 (≠ A117), P131 (≠ S139), L135 (= L143), G140 (≠ A148)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 97% coverage: 7:264/266 of query aligns to 40:288/290 of P14604
- E144 (≠ D120) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ F140) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 97% coverage: 7:264/266 of query aligns to 10:256/258 of 1mj3A
- active site: A68 (≠ G65), M73 (= M70), S83 (≠ Q93), L85 (≠ I95), G109 (≠ A117), E112 (≠ D120), P131 (≠ S139), E132 (≠ F140), T137 (≠ L145), P139 (≠ S147), G140 (≠ A148), K225 (≠ E233), F235 (≠ Q243)
- binding hexanoyl-coenzyme a: K26 (≠ A23), A27 (≠ T24), L28 (≠ R25), A30 (= A27), A66 (= A63), G67 (= G64), A68 (≠ G65), D69 (≠ N66), I70 (= I67), G109 (≠ A117), P131 (≠ S139), E132 (≠ F140), L135 (= L143), G140 (≠ A148)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
32% identity, 97% coverage: 7:264/266 of query aligns to 9:252/254 of 2dubA
- active site: A67 (≠ G65), M72 (= M70), S82 (≠ A90), G105 (≠ A117), E108 (≠ D120), P127 (≠ S139), E128 (≠ F140), T133 (≠ L145), P135 (≠ S147), G136 (≠ A148), K221 (≠ E233), F231 (≠ Q243)
- binding octanoyl-coenzyme a: K25 (≠ A23), A26 (≠ T24), L27 (≠ R25), A29 (= A27), A65 (= A63), A67 (≠ G65), D68 (≠ N66), I69 (= I67), K70 (= K68), G105 (≠ A117), E108 (≠ D120), P127 (≠ S139), E128 (≠ F140), G136 (≠ A148), A137 (= A149)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 97% coverage: 8:264/266 of query aligns to 8:258/260 of 2hw5C
- active site: A68 (≠ G65), M73 (= M70), S83 (≠ Q89), L87 (≠ Q93), G111 (≠ A117), E114 (≠ D120), P133 (≠ S139), E134 (≠ F140), T139 (≠ L145), P141 (≠ S147), G142 (≠ A148), K227 (≠ E233), F237 (≠ Q243)
- binding crotonyl coenzyme a: K26 (≠ A23), A27 (≠ T24), L28 (≠ R25), A30 (= A27), K62 (≠ D59), I70 (= I67), F109 (≠ M115)
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
36% identity, 84% coverage: 5:227/266 of query aligns to 2:199/224 of 3p85A
- active site: L62 (≠ G65), L67 (≠ M70), P68 (≠ A82), G92 (≠ A117), E95 (≠ D120), T114 (≠ S139), H115 (≠ F140), L120 (= L145), P122 (≠ S147), T123 (≠ A148)
- binding calcium ion: D43 (= D46), D45 (≠ S48)
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
30% identity, 97% coverage: 6:263/266 of query aligns to 15:266/273 of Q5HH38
- R34 (= R25) binding in other chain
- SGGDQ 73:77 (≠ AGGNI 63:67) binding in other chain
- S149 (≠ L145) binding in other chain
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
30% identity, 97% coverage: 6:263/266 of query aligns to 10:253/260 of 2uzfA
- active site: G70 (= G65), R80 (= R73), L84 (≠ Q93), G108 (≠ A117), V111 (≠ D120), T130 (≠ S139), G131 (≠ F140), S136 (≠ L145), D138 (≠ S147), A139 (= A148), A225 (= A235), Y233 (≠ Q243)
- binding acetoacetyl-coenzyme a: V28 (≠ T24), R29 (= R25), S68 (≠ A63), G69 (= G64), G70 (= G65), D71 (≠ N66), Y104 (≠ A113), G108 (≠ A117)
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
31% identity, 93% coverage: 17:263/266 of query aligns to 37:278/285 of Q7CQ56
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
30% identity, 93% coverage: 17:263/266 of query aligns to 37:278/285 of 4i42A
- active site: G86 (= G65), R91 (= R73), Y97 (≠ A81), H105 (≠ Q89), L109 (≠ Q93), G133 (≠ A117), V136 (≠ D120), G156 (≠ F140), S161 (≠ L145), D163 (≠ S147), G164 (≠ A148), A250 (= A235), Y258 (≠ Q243)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ T24), R45 (= R25), S84 (≠ A63), G85 (= G64), G86 (= G65), D87 (≠ N66), Q88 (≠ I67), K89 (= K68), Y97 (≠ A81), V108 (= V92), Y129 (≠ A113), G133 (≠ A117), T155 (≠ S139), S161 (≠ L145), T254 (≠ Q239), F270 (≠ A255), K273 (= K258)
Query Sequence
>Ga0059261_2803 FitnessBrowser__Korea:Ga0059261_2803
MSGPVLKAEREGPILILTIDDPATRNALSPELTRALVAACAEANADMSVSCVILTGAGDV
FCAGGNIKDMYARANHFAGNAAEIRRTYQAGVQTIARALYDLEVPSIAAVNGAAMGAGMD
FATMCTMRIASERAKFAESFIKLGLTSAAGGAWFLNRAIGASAAAELALTGDTIDAARAL
EIGLVSGVVPHAALLDEARALAKRIARHPAHSIRLNTRLLRESARLDLSAALEIASAMQA
VVQQTDDQYEAVAAAVEKRPPAYKGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory