SitesBLAST
Comparing Ga0059261_2816 FitnessBrowser__Korea:Ga0059261_2816 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O18404 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxyacyl-CoA dehydrogenase type II; Hydroxysteroid dehydrogenase; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.62; EC 1.1.1.-; EC 1.1.1.53 from Drosophila melanogaster (Fruit fly) (see paper)
51% identity, 96% coverage: 9:256/259 of query aligns to 7:253/255 of O18404
- L33 (≠ I35) mutation to Q: Lethal allele.
- F120 (= F124) mutation to I: Lethal allele.
4xgnA Crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with NAD from burkholderia thailandensis
53% identity, 95% coverage: 10:256/259 of query aligns to 12:252/255 of 4xgnA
- active site: Y161 (= Y165), K165 (= K169)
- binding nicotinamide-adenine-dinucleotide: G15 (= G13), S18 (= S16), G19 (= G17), L20 (= L18), D39 (= D37), L40 (= L38), C59 (≠ V57), D60 (= D58), V61 (= V59), C86 (= C85), A87 (= A86), V113 (= V118), T146 (= T150), Y161 (= Y165), K165 (= K169), P191 (= P195), I193 (= I197), F194 (= F198), T196 (= T200), M198 (≠ P202)
O70351 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Rattus norvegicus (Rat) (see paper)
48% identity, 97% coverage: 7:256/259 of query aligns to 11:259/261 of O70351
- S155 (= S152) binding
- Y168 (= Y165) active site, Proton acceptor
1e3wD Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate (see paper)
48% identity, 97% coverage: 7:256/259 of query aligns to 5:253/255 of 1e3wD
- active site: G15 (= G17), N115 (= N119), T147 (= T150), S149 (= S152), Y162 (= Y165), K166 (= K169), F195 (= F198)
- binding acetoacetic acid: Y162 (= Y165), T202 (≠ G205)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), S14 (= S16), G15 (= G17), L16 (= L18), D35 (= D37), V36 (≠ L38), N58 (≠ D58), V59 (= V59), C85 (= C85), A86 (= A86), G87 (= G87), V114 (= V118), T147 (= T150), Y162 (= Y165), K166 (= K169), P192 (= P195), L194 (≠ I197), F195 (= F198), T197 (= T200), L199 (≠ P202)
7n09A Structural basis for branched substrate selectivity in a ketoreductase from ascaris suum
48% identity, 97% coverage: 7:257/259 of query aligns to 9:258/259 of 7n09A
- binding nicotinamide-adenine-dinucleotide: G15 (= G13), S18 (= S16), G19 (= G17), L20 (= L18), D39 (= D37), L40 (= L38), S62 (≠ D58), V63 (= V59), C89 (= C85), A90 (= A86), S153 (= S152), Y166 (= Y165), K170 (= K169), P196 (= P195), G197 (= G196), I198 (= I197), F199 (= F198), T201 (= T200), M203 (≠ P202)
1u7tA Crystal structure of abad/hsd10 with a bound inhibitor (see paper)
47% identity, 97% coverage: 7:256/259 of query aligns to 5:253/255 of 1u7tA
- active site: G15 (= G17), N115 (= N119), T147 (= T150), S149 (= S152), Y162 (= Y165), K166 (= K169), F195 (= F198)
- binding 1-azepan-1-yl-2-phenyl-2-(4-thioxo-1,4-dihydro-pyrazolo[3,4-d]pyrimidin-5-yl)ethanone adduct: G11 (= G13), S14 (= S16), G15 (= G17), L16 (= L18), D35 (= D37), L36 (= L38), D58 (= D58), V59 (= V59), C85 (= C85), A86 (= A86), G87 (= G87), A89 (≠ G89), V90 (≠ N90), A91 (≠ S91), T147 (= T150), S149 (= S152), Q156 (= Q159), Q159 (= Q162), Y162 (= Y165), K166 (= K169), P192 (= P195), L194 (≠ I197), F195 (= F198), T197 (= T200), L199 (≠ P202), L200 (≠ M203), L203 (≠ V206)
O08756 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Mus musculus (Mouse)
47% identity, 97% coverage: 7:256/259 of query aligns to 11:259/261 of O08756
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
Q99714 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Homo sapiens (Human) (see 14 papers)
47% identity, 97% coverage: 7:256/259 of query aligns to 11:259/261 of Q99714
- V12 (≠ S8) to L: in HSD10MD; decreased dehydrogenase activity; decreased tRNA methylation; decreased mitochondrial tRNA 5'-end processing
- S20 (= S16) binding ; mutation to F: Decreased dehydrogenase activity. Does not affect mitochondrial tRNA 5'-end processing. Does not affect tRNA methylation.
- L22 (= L18) binding
- D41 (= D37) binding
- D64 (= D58) binding
- V65 (= V59) binding ; to A: in HSD10MD; uncertain significance; dbSNP:rs104886492
- D86 (≠ R80) to G: in HSD10MD; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; no effect on NAD(+) binding; complete loss of phospholipase C-like activity toward cardiolipin; dbSNP:rs587777651
- C91 (= C85) binding
- R130 (≠ T128) to C: in HSD10MD; decreased stability; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; decreased mitochondrial tRNA 5'-end processing; decreased tRNA methylation; does not affect homotetramerization; complete loss of phospholipase C-like activity toward cardiolipin; dbSNP:rs28935475
- S155 (= S152) binding
- Q165 (= Q162) to H: in HSD10MD; loss of 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; does not bind NAD(+); complete loss of phospholipase C-like activity toward cardiolipin
- Y168 (= Y165) active site, Proton acceptor; binding
- K172 (= K169) binding ; mutation to A: Abolishes dehydrogenase activity. Does not affect mitochondrial tRNA 5'-end processing. Does not affect tRNA methylation. Does not affect homotetramerization.
- V176 (= V173) to M: in HSD10MD; decreased dehydrogenase activity; strongly decreased tRNA methylation; strongly decreased mitochondrial tRNA 5'-end processing
- F201 (= F198) binding
- T203 (= T200) binding
- P210 (= P207) to S: in HSD10MD; decreased 3-hydroxyacyl-CoA dehydrogenase activity; decreased mitochondrial tRNA 5'-end processing; decreased tRNA methylation; does not affect homotetramerization
- K212 (≠ N209) to E: in HSD10MD; 4-fold decrease of 3-hydroxyacyl-CoA dehydrogenase activity; decreased interaction with TRMT10C; decreased function in mitochondrial tRNA methylation; decreased function in mitochondrial tRNA processing; dbSNP:rs886041974
- R226 (= R223) to Q: in HSD10MD; strongly decreased 3-hydroxyacyl-CoA dehydrogenase activity; abolished mitochondrial tRNA 5'-end processing; abolished tRNA methylation; impaired homotetramerization; dbSNP:rs1556894502
- N247 (= N244) to S: in HSD10MD; strongly decreased 3-hydroxyacyl-CoA dehydrogenase activity; abolished mitochondrial tRNA 5'-end processing; abolished tRNA methylation; impaired homotetramerization; dbSNP:rs122461163
- E249 (= E246) to Q: in HSD10MD; decreased 3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity; dbSNP:rs62626305
7onuC Structure of human mitochondrial rnase p in complex with mitochondrial pre-tRNA-tyr (see paper)
47% identity, 97% coverage: 7:256/259 of query aligns to 5:253/255 of 7onuC
- binding nicotinamide-adenine-dinucleotide: S14 (= S16), G15 (= G17), L16 (= L18), D35 (= D37), L36 (= L38), V59 (= V59), C85 (= C85), S149 (= S152), Y162 (= Y165), F195 (= F198), T197 (= T200)
- binding : S92 (≠ I92), K93 (= K93)
6ujkA Crystal structure of a probable short-chain type dehydrogenase/reductase (rv1144) from mycobacterium tuberculosis with bound NAD
46% identity, 100% coverage: 1:259/259 of query aligns to 2:246/246 of 6ujkA
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), S16 (= S16), G17 (= G17), L18 (= L18), D37 (= D37), L38 (= L38), D57 (= D58), V58 (= V59), C83 (= C85), A84 (= A86), T142 (= T150), S144 (= S152), Y157 (= Y165), K161 (= K169), G188 (= G196), F190 (= F198), T192 (= T200), L194 (≠ P202)
1e6wC Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol (see paper)
46% identity, 97% coverage: 7:256/259 of query aligns to 5:246/248 of 1e6wC
- active site: G15 (= G17), N115 (= N119), T147 (= T150), S149 (= S152), Y162 (= Y165), K166 (= K169), F195 (= F198)
- binding estradiol: Q159 (= Q162), Y162 (= Y165), L200 (≠ M203)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), S14 (= S16), G15 (= G17), L16 (= L18), D35 (= D37), V36 (≠ L38), N58 (≠ D58), V59 (= V59), C85 (= C85), A86 (= A86), T147 (= T150), Y162 (= Y165), K166 (= K169), P192 (= P195), L194 (≠ I197), F195 (= F198), T197 (= T200), L199 (≠ P202)
4o5oB X-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis
47% identity, 99% coverage: 1:256/259 of query aligns to 7:258/261 of 4o5oB
Sites not aligning to the query:
2o23B The structure of wild-type human hadh2 (17beta-hydroxysteroid dehydrogenase type 10) bound to NAD+ at 1.2 a
46% identity, 97% coverage: 7:256/259 of query aligns to 11:251/255 of 2o23B
- active site: G21 (= G17), N121 (= N119), T153 (= T150), S155 (= S152), Y168 (= Y165), K172 (= K169), F201 (= F198)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), S20 (= S16), G21 (= G17), L22 (= L18), D41 (= D37), L42 (= L38), D64 (= D58), V65 (= V59), C91 (= C85), A92 (= A86), T153 (= T150), Y168 (= Y165), K172 (= K169), P198 (= P195), L200 (≠ I197), F201 (= F198), T203 (= T200), L205 (≠ P202)
1uayA Crystal structure of type ii 3-hydroxyacyl-coa dehydrogenase from thermus thermophilus hb8
45% identity, 97% coverage: 8:259/259 of query aligns to 3:241/241 of 1uayA
- active site: G12 (= G17), S134 (= S152), Y147 (= Y165), K151 (= K169)
- binding adenosine: G8 (= G13), S11 (= S16), D32 (= D37), L33 (= L38), D46 (= D58), V47 (= V59), A73 (= A86), G74 (= G87)
3ppiA Crystal structure of 3-hydroxyacyl-coa dehydrogenase type-2 from mycobacterium avium (see paper)
41% identity, 96% coverage: 8:256/259 of query aligns to 9:255/258 of 3ppiA
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 96% coverage: 9:256/259 of query aligns to 10:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N119), S139 (= S152), Q149 (= Q162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (≠ T101), K98 (≠ Y106), S139 (= S152), N146 (≠ Q159), V147 (≠ M160), Q149 (= Q162), Y152 (= Y165), F184 (≠ I197), M189 (≠ P202), K200 (≠ V213)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (≠ L18), D38 (= D37), F39 (≠ L38), V59 (= V57), D60 (= D58), V61 (= V59), N87 (≠ C85), A88 (= A86), G89 (= G87), I90 (≠ T88), T137 (= T150), S139 (= S152), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (≠ I197), T185 (≠ F198), T187 (= T200), M189 (≠ P202)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
34% identity, 98% coverage: 1:254/259 of query aligns to 4:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (≠ S16), G19 (= G17), I20 (≠ L18), D39 (= D37), R40 (≠ L38), C63 (≠ V57), I65 (≠ V59), N91 (≠ T94), G93 (= G96), I94 (≠ V97), V114 (= V118), Y155 (= Y165), K159 (= K169), I188 (≠ F198), T190 (= T200), T193 (≠ M203)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
36% identity, 95% coverage: 9:254/259 of query aligns to 4:249/253 of 4nbwA
- active site: G12 (= G17), S146 (= S152), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), N11 (≠ S16), G12 (= G17), I13 (≠ L18), D32 (= D37), L33 (= L38), V57 (= V57), D58 (= D58), V59 (= V59), N85 (≠ C85), A86 (= A86), G87 (= G87), S146 (= S152), Y159 (= Y165), K163 (= K169), I192 (≠ F198), T194 (= T200)
A0A3Q8GLE8 (+)-cis,cis-nepetalactol synthase NEPS3; Nepetalactol-related short-chain reductase 3; NmNEPS3; EC 5.5.1.35 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
34% identity, 87% coverage: 2:227/259 of query aligns to 11:228/270 of A0A3Q8GLE8
- 21:27 (vs. 13:19, 86% identical) binding
- DIQ 46:48 (≠ DLN 37:39) binding
- DV 70:71 (= DV 58:59) binding
- N97 (≠ C85) binding
- N150 (≠ T150) mutation to T: No effect on catalytic activity.
- S154 (≠ A154) mutation to L: Abolishes catalytic activity.
- YVMSK 165:169 (≠ YSASK 165:169) binding
- K169 (= K169) mutation to M: Abolishes catalytic activity.
- M196 (≠ G196) mutation to S: Abolishes catalytic activity.
- VATPL 198:202 (≠ FATPP 198:202) binding
6f9qC Binary complex of a 7s-cis-cis-nepetalactol cyclase from nepeta mussinii with NAD+ (see paper)
34% identity, 87% coverage: 2:227/259 of query aligns to 5:222/260 of 6f9qC
- active site: G19 (= G17), Y159 (= Y165)
- binding nicotinamide-adenine-dinucleotide: G15 (= G13), S18 (= S16), G19 (= G17), I20 (≠ L18), D40 (= D37), I41 (≠ L38), Q42 (≠ N39), C63 (≠ V57), D64 (= D58), V65 (= V59), N91 (≠ C85), A92 (= A86), G93 (= G87), N144 (≠ T150), Y159 (= Y165), K163 (= K169), P189 (= P195), M190 (≠ G196), V192 (≠ F198), T194 (= T200), P195 (= P201), L196 (≠ P202), T197 (≠ M203)
Query Sequence
>Ga0059261_2816 FitnessBrowser__Korea:Ga0059261_2816
MKLDSSISAIVTGGASGLGHATAKAIAETGAKVAIFDLNEELGEKVAAEIGGIFCKVDVL
SDESVDAAFEKARSANGQERVLVNCAGTGNSIKTAGVDKKTGEIKYFPSDKFAWVLMVNT
VGTFRCITRSAAGMLTLDPVDGERGAIVCTASAAAQDGQMGQAAYSASKAAVVGMTLPIA
RDLSGSAIRINTIMPGIFATPPMLGVPDNVRSVLEASVPFPKRFGAPAEYASLVLEMVRN
GYFNGETVRLDGAIRMPMR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory