SitesBLAST
Comparing Ga0059261_2819 FitnessBrowser__Korea:Ga0059261_2819 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
33% identity, 96% coverage: 5:218/222 of query aligns to 5:241/245 of 4k6fB
- active site: G12 (= G12), N102 (≠ S91), S138 (≠ A124), Y151 (= Y137), K155 (= K141)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), Y32 (≠ I33), S33 (≠ A34), N36 (≠ Q37), V58 (= V47), D59 (= D48), V60 (≠ L49), A87 (= A76), G88 (= G77), I89 (≠ G78)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
30% identity, 89% coverage: 4:201/222 of query aligns to 10:218/255 of 5itvA
- active site: G18 (= G12), S141 (≠ A124), Y154 (= Y137), K158 (= K141)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G8), S17 (≠ G11), G18 (= G12), I19 (≠ L13), D38 (= D32), I39 (= I33), T61 (≠ V47), I63 (≠ L49), N89 (≠ V75), G91 (= G77), T139 (≠ V122), S141 (≠ A124), Y154 (= Y137), K158 (= K141), P184 (= P167), G185 (≠ T168), I186 (= I169), I187 (≠ L170)
P09417 Dihydropteridine reductase; HDHPR; Quinoid dihydropteridine reductase; Short chain dehydrogenase/reductase family 33C member 1; EC 1.5.1.34 from Homo sapiens (Human) (see 6 papers)
33% identity, 94% coverage: 3:210/222 of query aligns to 12:218/244 of P09417
- L14 (≠ I5) to P: in HPABH4C; severe; dbSNP:rs756639609
- G17 (= G8) to R: in HPABH4C; severe; dbSNP:rs757483045; to V: in HPABH4C; severe
- G18 (= G9) to D: in HPABH4C; severe; dbSNP:rs1278371188
- G23 (= G14) to D: in HPABH4C; severe; dbSNP:rs104893863
- S51 (≠ R42) natural variant: S -> T
- Q66 (≠ T57) to R: in HPABH4C; severe; dbSNP:rs1252488251
- Y150 (= Y137) to C: in HPABH4C; mild; dbSNP:rs104893866
- H158 (≠ M145) to Y: in HPABH4C; severe; dbSNP:rs750201480
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
34% identity, 80% coverage: 5:181/222 of query aligns to 6:201/250 of 2cfcA
- active site: G13 (= G12), S142 (≠ A124), Y155 (= Y137), K159 (= K141)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ G131), R152 (≠ M134), Y155 (= Y137), W195 (vs. gap), R196 (= R176)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), S12 (≠ G11), G13 (= G12), N14 (≠ L13), D33 (= D32), L34 (≠ I33), A59 (≠ V47), D60 (= D48), V61 (≠ L49), N87 (vs. gap), A88 (vs. gap), G89 (vs. gap), I140 (≠ V122), P185 (= P167), G186 (≠ T168), M187 (≠ I169), I188 (≠ L170), T190 (= T172), P191 (= P173), M192 (≠ A174), T193 (≠ N175)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
34% identity, 80% coverage: 5:181/222 of query aligns to 6:201/250 of Q56840
- SGN 12:14 (≠ GGL 11:13) binding
- D33 (= D32) binding
- DV 60:61 (≠ DL 48:49) binding
- N87 (vs. gap) binding
- S142 (≠ A124) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ M134) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y137) mutation Y->E,F: Loss of activity.
- K159 (= K141) mutation to A: Loss of activity.
- R179 (= R161) mutation to A: Loss of activity.
- IETPM 188:192 (≠ LDTPA 170:174) binding
- WR 195:196 (≠ -R 176) binding
- R196 (= R176) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 203 R→A: Slight decrease in catalytic efficiency.
- 209 R→A: Does not affect catalytic efficiency.
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
33% identity, 93% coverage: 5:211/222 of query aligns to 14:242/258 of 4wecA
- active site: G21 (= G12), S143 (= S127), Q154 (vs. gap), Y157 (= Y137), K161 (= K141)
- binding nicotinamide-adenine-dinucleotide: G17 (= G8), A19 (≠ L10), S20 (≠ G11), G21 (= G12), I22 (≠ L13), D41 (= D32), I42 (= I33), V61 (= V47), D62 (= D48), V63 (≠ L49), N89 (≠ V75), T141 (≠ V122), Y157 (= Y137), K161 (= K141), P187 (= P167), P189 (≠ I169), V190 (≠ L170)
P11348 Dihydropteridine reductase; HDHPR; Quinoid dihydropteridine reductase; EC 1.5.1.34 from Rattus norvegicus (Rat) (see paper)
32% identity, 94% coverage: 3:211/222 of query aligns to 9:216/241 of P11348
- D38 (= D32) mutation to I: 3-fold decrease in catalytic efficiency for NADH.
- W105 (≠ Y96) mutation to F: No significant effect on catalytic efficiency for NADH.
Sites not aligning to the query:
- 7 A→V: No significant effect on catalytic efficiency for NADH.
1dhrA Crystal structure of rat liver dihydropteridine reductase (see paper)
32% identity, 94% coverage: 3:211/222 of query aligns to 4:211/236 of 1dhrA
- active site: Y142 (= Y137), K146 (= K141)
- binding nicotinamide-adenine-dinucleotide: Y8 (≠ T7), G12 (= G11), A13 (≠ G12), L14 (= L13), D33 (= D32), V46 (≠ A45), V78 (= V75), A79 (= A76), G80 (= G77), Q102 (≠ I98), T106 (= T102), A127 (≠ G123), Y142 (= Y137), V175 (≠ T168), T176 (≠ I169), L177 (= L170), N182 (= N175)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
30% identity, 93% coverage: 4:210/222 of query aligns to 16:247/267 of 3ay6B
- active site: G24 (= G12), S151 (≠ A124), Y164 (= Y137), K168 (= K141)
- binding beta-D-glucopyranose: E102 (≠ F79), S151 (≠ A124), H153 (≠ A126), W158 (≠ G131), Y164 (= Y137), N202 (= N175), K205 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G8), T23 (≠ G11), G24 (= G12), L25 (= L13), Y45 (≠ A34), D71 (= D48), V72 (≠ L49), N98 (≠ V75), A99 (= A76), G100 (= G77), V101 (≠ G78), M149 (≠ V122), S151 (≠ A124), Y164 (= Y137), K168 (= K141), P194 (= P167), G195 (≠ T168), M197 (≠ L170), T199 (= T172), P200 (= P173), I201 (≠ A174), N202 (= N175)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
31% identity, 96% coverage: 5:218/222 of query aligns to 9:236/239 of 4nbtA
- active site: G16 (= G12), S132 (≠ A124), Y145 (= Y137), K149 (= K141)
- binding nicotinamide-adenine-dinucleotide: G12 (= G8), K15 (≠ G11), G16 (= G12), L17 (= L13), D36 (= D32), L37 (≠ I33), L52 (≠ V47), N53 (≠ D48), V54 (≠ L49), N80 (≠ V75), A81 (= A76), G82 (= G77), I130 (≠ V122), S132 (≠ A124), Y145 (= Y137), K149 (= K141), P177 (= P167), G178 (≠ T168), I180 (≠ L170), T182 (= T172)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
32% identity, 95% coverage: 5:215/222 of query aligns to 12:241/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G8), R18 (≠ G11), G19 (= G12), I20 (≠ L13), D39 (= D32), R40 (≠ I33), C63 (≠ V47), I65 (≠ L49), N91 (≠ V75), G93 (= G77), I94 (≠ G78), V114 (≠ I98), Y155 (= Y137), K159 (= K141), I188 (≠ L170), T190 (= T172), T193 (≠ N175)
1iy8A Crystal structure of levodione reductase (see paper)
31% identity, 99% coverage: 4:222/222 of query aligns to 7:257/258 of 1iy8A
- active site: G15 (= G12), S143 (≠ A125), Q153 (≠ M134), Y156 (= Y137), K160 (= K141)
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), S14 (≠ G11), G15 (= G12), L16 (= L13), D35 (= D32), V36 (≠ I33), A62 (≠ V47), D63 (= D48), V64 (≠ L49), N90 (≠ V75), G92 (= G77), I93 (vs. gap), T141 (≠ V122), S143 (≠ A125), Y156 (= Y137), K160 (= K141), P186 (= P167), G187 (≠ T168), T191 (= T172), P192 (= P173), M193 (≠ A174)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
31% identity, 99% coverage: 4:222/222 of query aligns to 16:266/267 of Q9LBG2
- 17:42 (vs. 5:30, 38% identical) binding
- E103 (≠ G78) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
30% identity, 97% coverage: 4:218/222 of query aligns to 10:242/252 of 6vspB
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
30% identity, 97% coverage: 4:218/222 of query aligns to 8:240/251 of 6xewA
- active site: G16 (= G12), S138 (≠ A124), Y151 (= Y137)
- binding r,3-hydroxybutan-2-one: S138 (≠ A124), S140 (≠ A126), Y151 (= Y137)
- binding s,3-hydroxybutan-2-one: S138 (≠ A124), Y151 (= Y137), S182 (≠ T168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G8), N15 (≠ G11), G16 (= G12), M17 (≠ L13), D36 (= D32), W37 (≠ I33), W37 (≠ I33), A38 (= A34), I59 (≠ V47), D60 (= D48), V61 (≠ L49), N87 (≠ V75), A88 (= A76), G89 (= G77), V110 (≠ I98), T136 (≠ V122), S138 (≠ A124), Y151 (= Y137), K155 (= K141), S182 (≠ T168), L183 (≠ I169), V184 (≠ L170), T186 (= T172), N187 (vs. gap), M188 (vs. gap), T189 (vs. gap)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
30% identity, 97% coverage: 4:218/222 of query aligns to 8:240/251 of 6vspA
- active site: G16 (= G12), S138 (≠ A124), Y151 (= Y137)
- binding nicotinamide-adenine-dinucleotide: G12 (= G8), N15 (≠ G11), G16 (= G12), M17 (≠ L13), D36 (= D32), W37 (≠ I33), W37 (≠ I33), A38 (= A34), I59 (≠ V47), D60 (= D48), V61 (≠ L49), N87 (≠ V75), A88 (= A76), G89 (= G77), V90 (≠ G78), V110 (≠ I98), T136 (≠ V122), S138 (≠ A124), Y151 (= Y137), K155 (= K141), P181 (= P167), S182 (≠ T168), L183 (≠ I169), V184 (≠ L170), T186 (= T172), N187 (vs. gap), M188 (vs. gap), T189 (vs. gap)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
30% identity, 97% coverage: 4:218/222 of query aligns to 8:240/251 of H9XP47
- N15 (≠ G11) binding
- M17 (≠ L13) binding
- D36 (= D32) binding
- D60 (= D48) binding
- V61 (≠ L49) binding
- N87 (≠ V75) binding
- S138 (≠ A124) binding ; binding
- V139 (≠ A125) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A126) binding
- Y151 (= Y137) binding ; binding ; binding
- K155 (= K141) binding
- V184 (≠ L170) binding
- T186 (= T172) binding
- RDK 197:199 (≠ KDM 177:179) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
34% identity, 96% coverage: 5:218/222 of query aligns to 10:243/246 of 5u2wA
- active site: G17 (= G12), S141 (≠ A124), M152 (= M134), Y155 (= Y137), K159 (= K141)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G8), S15 (≠ L10), R16 (≠ G11), G17 (= G12), I18 (≠ L13), Y37 (≠ I33), E38 (≠ A34), K39 (≠ S35), S40 (≠ G36), A63 (vs. gap), D64 (= D48), S65 (≠ L49), N91 (≠ V75), A92 (= A76), G93 (= G77), T139 (≠ V122), Y155 (= Y137), K159 (= K141), P185 (= P167), G186 (≠ T168), T188 (≠ L170), T190 (= T172), M192 (≠ A174), N193 (= N175)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
32% identity, 96% coverage: 5:218/222 of query aligns to 5:236/239 of 3sj7A
- active site: G12 (= G12), S138 (≠ A124), Q148 (≠ M134), Y151 (= Y137), K155 (= K141)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), S10 (≠ L10), R11 (≠ G11), I13 (≠ L13), N31 (≠ D32), Y32 (≠ I33), A33 (= A34), G34 (≠ S35), S35 (≠ G36), A58 (vs. gap), N59 (vs. gap), V60 (≠ L49), N86 (≠ V75), A87 (= A76), T109 (≠ I98), S138 (≠ A124), Y151 (= Y137), K155 (= K141), P181 (= P167), G182 (≠ T168)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
32% identity, 96% coverage: 5:218/222 of query aligns to 12:248/251 of 4cqlI
- active site: G19 (= G12), S146 (≠ A124), Y159 (= Y137), K163 (= K141)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ G11), G19 (= G12), I20 (≠ L13), D39 (= D32), L40 (≠ I33), A64 (≠ T57), D65 (≠ A58), V66 (≠ F59), C93 (≠ V75), A94 (= A76), G95 (= G77), I96 (≠ G78), V116 (≠ I98), I144 (≠ V122), S146 (≠ A124), Y159 (= Y137), K163 (= K141), P189 (= P167), G190 (≠ T168), I192 (≠ L170), T194 (= T172), M196 (≠ A174)
Query Sequence
>Ga0059261_2819 FitnessBrowser__Korea:Ga0059261_2819
MGHVIVTGGLGGLGRAVVTTLKSRGHRVVAVDIASGQSDADRVIAGVDLADETAVATAFS
EAAGALGEIDALVNVAGGFTWEPVETGSMASWDAMYRINLRTAAISSRAVLPHLKSGAIV
NVGAAASAAPGMGMAPYAASKAGVMALTESLAEELRGRGIRVNAILPTILDTPANRKDMP
DADPAGWVSLESAAAVVAFLLSQDAAAITGTGIKLSLGTAGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory