SitesBLAST
Comparing Ga0059261_2836 FitnessBrowser__Korea:Ga0059261_2836 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
30% identity, 91% coverage: 1:263/290 of query aligns to 14:288/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ D10), M24 (≠ Q11), N43 (≠ A30), R44 (= R31), T45 (≠ R32), K48 (≠ A35), V77 (= V64), S78 (≠ T65), D82 (= D69), Q85 (≠ E72), V133 (= V119), F244 (vs. gap), K245 (≠ R225), H248 (= H228), K251 (= K235)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
30% identity, 91% coverage: 1:263/290 of query aligns to 14:285/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G7), L21 (= L8), G22 (= G9), I23 (≠ D10), M24 (≠ Q11), N43 (≠ A30), R44 (= R31), T45 (≠ R32), K48 (≠ A35), M76 (≠ C63), V77 (= V64), S78 (≠ T65), D82 (= D69), Q85 (≠ E72), V133 (= V119), F241 (vs. gap), K242 (≠ R225), H245 (= H228), K248 (= K235)
- binding sulfate ion: T134 (≠ S120), G135 (= G121), K183 (= K169)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
31% identity, 83% coverage: 3:243/290 of query aligns to 41:291/335 of P29266
- D68 (≠ A30) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K169) mutation K->A,H,N,R: Complete loss of activity.
- N212 (= N173) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 84% coverage: 1:243/290 of query aligns to 1:253/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ D10), M11 (≠ Q11), Y29 (≠ W29), D30 (≠ A30), V31 (≠ R31), M63 (≠ L62), L64 (≠ C63), P65 (≠ V64), T95 (= T94), V120 (= V119), G122 (= G121), F238 (vs. gap), K245 (= K235)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 83% coverage: 3:243/290 of query aligns to 42:292/336 of P31937
- LP 103:104 (≠ CV 63:64) binding
- N108 (≠ A68) binding
- T134 (= T94) binding
- K284 (= K235) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
5u5gA Psf3 in complex with NADP+ and 2-opp (see paper)
29% identity, 91% coverage: 3:265/290 of query aligns to 3:269/286 of 5u5gA
- binding (2-oxopropyl)phosphonic acid: S122 (= S120), G123 (= G121), G124 (≠ S122), K171 (= K169), N175 (= N173), E178 (≠ A176), Y215 (≠ A213)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), G9 (= G9), R10 (≠ D10), M11 (≠ Q11), N30 (≠ A30), R31 (= R31), S32 (≠ R32), K35 (≠ A35), C63 (= C63), T64 (≠ V64), A65 (≠ T65), A69 (≠ D69), F73 (≠ L73), S95 (= S93), T96 (= T94), V232 (≠ H228), V236 (= V232), K239 (= K235)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
32% identity, 70% coverage: 4:207/290 of query aligns to 5:209/287 of 3pduA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), G10 (= G9), I11 (≠ D10), M12 (≠ Q11), N31 (≠ A30), R32 (= R31), N33 (≠ R32), M64 (≠ C63), L65 (≠ V64), A66 (≠ T65), A70 (≠ D69), T96 (= T94), V121 (= V119), G123 (= G121), T124 (≠ S122), K171 (= K169)
Sites not aligning to the query:
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
29% identity, 82% coverage: 2:240/290 of query aligns to 3:229/287 of 3pefA
- binding glycerol: D67 (≠ G66), G123 (= G121), K171 (= K169), N175 (= N173), M178 (≠ A176), L203 (≠ I214), G207 (≠ A218), N213 (≠ K224), A217 (≠ H228)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G9), I11 (≠ D10), M12 (≠ Q11), N31 (≠ A30), R32 (= R31), S33 (≠ R32), K36 (≠ A35), M64 (≠ C63), L65 (≠ V64), A66 (≠ T65), A70 (≠ D69), E73 (= E72), T96 (= T94), V121 (= V119), G123 (= G121), S124 (= S122)
Sites not aligning to the query:
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
31% identity, 60% coverage: 3:177/290 of query aligns to 4:179/298 of P0A9V8
- QM 11:12 (≠ DQ 10:11) binding
- D31 (≠ A30) binding
- L65 (≠ V64) binding
- T96 (= T94) binding
- G122 (≠ S120) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G121) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ S122) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NNLMA 172:176) binding
Sites not aligning to the query:
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
31% identity, 60% coverage: 3:177/290 of query aligns to 3:178/294 of 6smyA
Sites not aligning to the query:
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
31% identity, 60% coverage: 3:177/290 of query aligns to 3:178/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q10 (≠ D10), M11 (≠ Q11), F29 (≠ W29), D30 (≠ A30), V31 (≠ R31), M63 (≠ C63), L64 (≠ V64), V73 (≠ L73), S94 (= S93), T95 (= T94), R122 (≠ G121)
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
33% identity, 74% coverage: 2:216/290 of query aligns to 2:216/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), H10 (≠ D10), M11 (≠ Q11), F29 (≠ W29), D30 (≠ A30), L31 (≠ R31), M63 (≠ C63), L64 (≠ V64), P65 (≠ T65), T94 (= T94), V119 (= V119), G121 (= G121)
Sites not aligning to the query:
2uyyA Structure of the cytokine-like nuclear factor n-pac
26% identity, 83% coverage: 2:241/290 of query aligns to 8:250/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G9), L16 (≠ D10), M17 (≠ Q11), N36 (≠ A30), R37 (= R31), T38 (≠ R32), V70 (= V64), S71 (≠ T65), A75 (≠ D69), T101 (= T94), F237 (≠ H228), Y238 (≠ V229), Y241 (≠ V232), K244 (= K235)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
30% identity, 83% coverage: 2:241/290 of query aligns to 2:239/288 of 1wp4A
- active site: S116 (= S120), K164 (= K169), N167 (= N172), N168 (= N173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G7), L8 (= L8), G9 (= G9), A10 (≠ D10), M11 (≠ Q11), N29 (≠ A30), R30 (= R31), T31 (≠ R32), K34 (≠ A35), C61 (= C63), L62 (≠ V64), P63 (≠ T65), E67 (≠ D69), S90 (≠ T94), V115 (= V119), T225 (vs. gap), F226 (≠ H228), K233 (= K235)
- binding sulfate ion: S116 (= S120), G117 (= G121), G118 (≠ S122), K164 (= K169)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
30% identity, 83% coverage: 2:241/290 of query aligns to 3:240/289 of 2cvzC
- active site: S117 (= S120), K165 (= K169), N168 (= N172), N169 (= N173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G7), L9 (= L8), G10 (= G9), A11 (≠ D10), M12 (≠ Q11), N30 (≠ A30), R31 (= R31), T32 (≠ R32), C62 (= C63), L63 (≠ V64), P64 (≠ T65), E68 (≠ D69), E71 (= E72), S91 (≠ T94), V116 (= V119), F227 (≠ H228), K234 (= K235)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
26% identity, 74% coverage: 2:215/290 of query aligns to 269:483/553 of Q49A26
- 271:285 (vs. 4:18, 40% identical) binding
- T362 (= T94) binding
- M437 (≠ K169) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
- 496 P → L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- 505 binding
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
33% identity, 74% coverage: 2:216/290 of query aligns to 3:218/298 of Q9I5I6
- P66 (≠ T65) binding
- T96 (= T94) binding ; mutation to A: Almost abolished activity.
- S122 (= S120) mutation to A: Strongly reduced activity.
- K171 (= K169) active site
- N175 (= N173) mutation to A: Strongly reduced activity.
- W214 (≠ F212) mutation to A: Almost abolished activity.
Sites not aligning to the query:
- 2:31 binding
- 219 Y→A: Strongly reduced activity.
- 246 binding ; K→A: Almost abolished activity.
- 247 D→A: Almost abolished activity.
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
33% identity, 74% coverage: 2:216/290 of query aligns to 3:217/295 of 3obbA
Sites not aligning to the query:
7puaFM uS11m (see paper)
27% identity, 73% coverage: 1:211/290 of query aligns to 6:230/327 of 7puaFM
Sites not aligning to the query:
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
33% identity, 73% coverage: 3:214/290 of query aligns to 3:212/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ M146), E148 (= E150), A151 (= A153), K153 (≠ T155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G7), G9 (= G9), N10 (≠ D10), M11 (≠ Q11), F29 (≠ W29), D30 (≠ A30), P31 (≠ R31), M63 (≠ L62), L64 (≠ C63), G120 (≠ S122)
Sites not aligning to the query:
Query Sequence
>Ga0059261_2836 FitnessBrowser__Korea:Ga0059261_2836
MRVGFIGLGDQGGPMARMIVDAGFPVTLWARRASAIERFVARGAGVAADPAALASACELV
CLCVTGDADVRELLIDRGMIAALRKRSLVAIHSTINPKTCVELARMVSARGATLLDMPVS
GSGHAALARKLLVMTGGDAGAIARTMPVLESYAGTIIRMGDVGAAMNAKLVNNLMAVVNI
GQAFHALALGRKVGVEPAALRQALMVGTGRSFAIDLIARLHVPKRAHHVRGVLVKDVDLA
IEAMPAGERAYWRPLAQAGLDALEQLISGGVTLLPVKEEEHGEYVVYGTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory