SitesBLAST
Comparing Ga0059261_2843 FitnessBrowser__Korea:Ga0059261_2843 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
39% identity, 94% coverage: 2:248/263 of query aligns to 7:253/258 of 4wecA
- active site: G21 (= G16), S143 (= S139), Q154 (≠ S150), Y157 (= Y152), K161 (= K156)
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A12), A19 (= A14), S20 (≠ N15), G21 (= G16), I22 (= I17), D41 (= D36), I42 (= I37), V61 (≠ A61), D62 (= D62), V63 (≠ M63), N89 (= N89), T141 (≠ V137), Y157 (= Y152), K161 (= K156), P187 (= P182), P189 (≠ L184), V190 (≠ I185)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 92% coverage: 3:245/263 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G16), S142 (= S139), Q152 (≠ F149), Y155 (= Y152), K159 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (≠ A12), S14 (≠ A14), R15 (≠ N15), G16 (= G16), I17 (= I17), N35 (≠ G35), Y36 (≠ H40), N37 (= N41), G38 (= G42), S39 (≠ A43), N63 (≠ D62), V64 (≠ M63), N90 (= N89), A91 (= A90), I93 (≠ G92), I113 (≠ L112), S142 (= S139), Y155 (= Y152), K159 (= K156), P185 (= P182), I188 (= I185), T190 (= T187)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
38% identity, 93% coverage: 3:247/263 of query aligns to 3:250/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A12), G16 (= G16), I17 (= I17), D36 (= D36), L37 (≠ I37), C61 (≠ A61), D62 (= D62), V63 (≠ M63), N89 (= N89), A90 (= A90), T140 (≠ V137), S142 (= S139), Y155 (= Y152), K159 (= K156), A186 (≠ D183), V187 (≠ L184)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 3:247/263 of query aligns to 3:247/248 of 4urfB
- active site: G16 (= G16), S142 (= S139), I152 (≠ F149), Y155 (= Y152), K159 (= K156)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L210), R211 (≠ G211), R212 (= R212)
- binding bicarbonate ion: I92 (vs. gap), G94 (= G91), R109 (= R108), R179 (= R176), S228 (= S228)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A12), G14 (≠ A14), N15 (= N15), G16 (= G16), I17 (= I17), D36 (= D36), I37 (= I37), D62 (= D62), T63 (≠ M63), N89 (= N89), A90 (= A90), G91 (vs. gap), I140 (≠ V137), Y155 (= Y152), K159 (= K156), P185 (= P182), A186 (≠ D183), I188 (= I185), T190 (= T187)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 3:247/263 of query aligns to 3:247/248 of 4urfA
- active site: G16 (= G16), S142 (= S139), I152 (≠ F149), Y155 (= Y152), K159 (= K156)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (vs. gap), S93 (vs. gap), G94 (= G91), E95 (≠ G92), T97 (≠ R94), E101 (≠ D100), T103 (≠ N102), Q106 (≠ N105), R109 (= R108), S175 (≠ P172), G177 (≠ A174)
- binding magnesium ion: S237 (≠ A237), Y238 (≠ T238)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A12), G14 (≠ A14), N15 (= N15), G16 (= G16), I17 (= I17), D36 (= D36), I37 (= I37), W41 (≠ N41), D62 (= D62), T63 (≠ M63), N89 (= N89), A90 (= A90), G91 (vs. gap), I140 (≠ V137), Y155 (= Y152), K159 (= K156), P185 (= P182), I188 (= I185), T190 (= T187)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
36% identity, 93% coverage: 3:247/263 of query aligns to 3:247/248 of 4ureB
- active site: G16 (= G16), S142 (= S139), I152 (≠ F149), Y155 (= Y152), K159 (= K156)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (= N15), G16 (= G16), I17 (= I17), N89 (= N89), G91 (vs. gap), Y155 (= Y152), P185 (= P182), A186 (≠ D183)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
33% identity, 93% coverage: 3:246/263 of query aligns to 11:257/267 of 3ay6B
- active site: G24 (= G16), S151 (= S139), Y164 (= Y152), K168 (= K156)
- binding beta-D-glucopyranose: E102 (≠ V93), S151 (= S139), H153 (≠ E141), W158 (≠ A146), Y164 (= Y152), N202 (≠ R191), K205 (≠ M194)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (≠ A12), T23 (≠ N15), G24 (= G16), L25 (≠ I17), Y45 (≠ I37), D71 (= D62), V72 (≠ M63), N98 (= N89), A99 (= A90), G100 (= G91), V101 (≠ G92), M149 (≠ V137), S151 (= S139), Y164 (= Y152), K168 (= K156), P194 (= P182), G195 (≠ D183), M197 (≠ I185), T199 (= T187), P200 (= P188), I201 (≠ L190), N202 (≠ R191)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
33% identity, 93% coverage: 3:246/263 of query aligns to 5:251/261 of 1g6kA
- active site: G18 (= G16), S145 (= S139), Y158 (= Y152), K162 (= K156)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ N15), G18 (= G16), L19 (≠ I17), R39 (≠ I37), D65 (= D62), V66 (≠ M63), N92 (= N89), A93 (= A90), G94 (= G91), M143 (≠ V137), S145 (= S139), Y158 (= Y152), P188 (= P182), G189 (≠ D183), I191 (= I185), T193 (= T187)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
33% identity, 93% coverage: 3:246/263 of query aligns to 5:251/261 of P40288
- 11:35 (vs. 9:33, 32% identical) binding
- E96 (≠ V93) mutation E->A,G,K: Heat stable.
- D108 (≠ N105) mutation to N: Heat stable.
- V112 (= V109) mutation to A: Heat stable.
- E133 (≠ N130) mutation to K: Heat stable.
- V183 (= V177) mutation to I: Heat stable.
- P194 (= P188) mutation to Q: Heat stable.
- E210 (≠ D205) mutation to K: Heat stable.
- Y217 (≠ R212) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
37% identity, 93% coverage: 2:245/263 of query aligns to 8:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (≠ A12), S20 (≠ A14), K21 (≠ N15), G22 (= G16), I23 (= I17), A43 (≠ I37), S44 (≠ D38), S45 (≠ A39), G68 (≠ A61), D69 (= D62), V70 (≠ M63), N96 (= N89), S97 (≠ A90), G98 (= G91), Y100 (≠ V93), I144 (≠ V137), S146 (= S139), Y159 (= Y152), K163 (= K156), P189 (= P182), G190 (≠ D183), M191 (≠ L184), I192 (= I185), T194 (= T187), G196 (= G189), T197 (= T196)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S139), Y159 (= Y152), M191 (≠ L184), I202 (= I201)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
41% identity, 93% coverage: 5:248/263 of query aligns to 5:239/240 of 2d1yA
- active site: G16 (= G16), S135 (= S139), N145 (≠ F149), Y148 (= Y152), K152 (= K156)
- binding nicotinamide-adenine-dinucleotide: G12 (≠ A12), R15 (≠ N15), I17 (= I17), D36 (= D36), L37 (≠ I37), R38 (≠ D38), V55 (≠ A61), D56 (= D62), L57 (≠ M63), N83 (= N89), A84 (= A90), A85 (≠ G91), I86 (≠ G92), V133 (= V137), S135 (= S139), Y148 (= Y152), K152 (= K156), P178 (= P182), G179 (≠ D183), I181 (= I185), T183 (= T187), A185 (≠ G189), V186 (≠ L190)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
36% identity, 94% coverage: 2:248/263 of query aligns to 4:245/245 of 5t5qC
- active site: G18 (= G16), S140 (= S139), N150 (≠ F149), Y153 (= Y152), K157 (= K156)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ A14), G17 (≠ N15), G18 (= G16), I19 (= I17), D38 (= D36), L39 (≠ I37), D63 (= D62), A64 (≠ M63), S90 (≠ N89), I113 (≠ L112), Y153 (= Y152), K157 (= K156), P182 (= P182), I185 (= I185), T187 (= T187), M189 (≠ G189)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
36% identity, 92% coverage: 3:244/263 of query aligns to 8:243/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (≠ A12), D19 (≠ A14), L22 (≠ I17), I42 (≠ A39), D65 (= D62), M66 (= M63), N92 (= N89), A93 (= A90), G94 (= G91), L115 (= L112), I143 (≠ V137), S145 (= S139), Y158 (= Y152), K162 (= K156), G189 (≠ D183), M191 (≠ I185), T193 (= T187), N195 (≠ G189)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
37% identity, 92% coverage: 3:245/263 of query aligns to 4:244/247 of P73574
- A14 (≠ G13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P147) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K156) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L184) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ P195) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
38% identity, 93% coverage: 3:247/263 of query aligns to 2:259/260 of 2ztlA
- active site: G15 (= G16), N114 (= N113), S142 (= S139), Y155 (= Y152), K159 (= K156), L200 (≠ D197)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ V93), S142 (= S139), H144 (≠ E141), K152 (≠ F149), Y155 (= Y152), Q196 (≠ H193)
- binding nicotinamide-adenine-dinucleotide: G11 (≠ A12), G15 (= G16), I16 (= I17), F36 (≠ A43), L64 (≠ M63), N90 (= N89), A91 (= A90), G92 (= G91), L113 (= L112), Y155 (= Y152), K159 (= K156), P185 (= P182), W187 (≠ L184), V188 (≠ I185), T190 (= T187), V193 (≠ L190)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
38% identity, 93% coverage: 3:247/263 of query aligns to 2:259/260 of 1wmbA
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 93% coverage: 1:245/263 of query aligns to 4:244/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (≠ A12), S17 (≠ A14), R18 (≠ N15), I20 (= I17), T40 (≠ D38), N62 (≠ D62), V63 (≠ M63), N89 (= N89), A90 (= A90), I92 (≠ G92), V139 (= V137), S141 (= S139), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (≠ D183), I187 (= I185), T189 (= T187), M191 (≠ G189)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
37% identity, 94% coverage: 2:247/263 of query aligns to 3:239/244 of 1nfqA
- active site: G17 (= G16), S139 (= S139), Y152 (= Y152), K156 (= K156)
- binding Androsterone: L91 (≠ V93), E141 (= E141), C149 (≠ F149), Y152 (= Y152), V193 (≠ M194), I197 (≠ P198), F198 (≠ A199)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ N15), G17 (= G16), M18 (≠ I17), D37 (= D36), L39 (≠ D38), L59 (≠ A61), D60 (= D62), V61 (≠ M63), N87 (= N89), A88 (= A90), I137 (≠ V137), S139 (= S139), Y152 (= Y152), K156 (= K156), P182 (= P182), V185 (≠ I185), T187 (= T187), P188 (= P188), M189 (≠ L190), T190 (≠ R191)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
37% identity, 94% coverage: 2:247/263 of query aligns to 3:239/244 of 1nffA
- active site: G17 (= G16), S139 (= S139), Y152 (= Y152), K156 (= K156)
- binding nicotinamide-adenine-dinucleotide: G13 (≠ A12), R16 (≠ N15), G17 (= G16), M18 (≠ I17), D37 (= D36), I38 (= I37), L39 (≠ D38), L59 (≠ A61), D60 (= D62), V61 (≠ M63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (≠ G92), I137 (≠ V137), S139 (= S139), Y152 (= Y152), K156 (= K156), P182 (= P182), V185 (≠ I185), T187 (= T187), P188 (= P188), M189 (≠ L190), T190 (≠ R191)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 93% coverage: 1:245/263 of query aligns to 4:240/243 of 4i08A
- active site: G19 (= G16), N113 (= N113), S141 (= S139), Q151 (≠ F149), Y154 (= Y152), K158 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (≠ A12), S17 (≠ A14), R18 (≠ N15), I20 (= I17), T40 (≠ D38), N62 (≠ D62), V63 (≠ M63), N89 (= N89), A90 (= A90), G140 (≠ A138), S141 (= S139), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (≠ D183), T189 (= T187)
Query Sequence
>Ga0059261_2843 FitnessBrowser__Korea:Ga0059261_2843
VQLQGKVAVVTAGANGIGEGAALALAGMGADIVLGDIDAHNGARVAAAIEAIGRRAAFRP
ADMMQADQARALVDFAAAEFGRIDILVNNAGGVRPRAFLDQNEGNWQRVTDLNFTSMLAA
TQSAARVMANGGAIVNVASTEALRAAPGFSVYAACKAAMVEFTKTMALELAPRAIRVNCI
APDLIDTPGLRPHMPTDPARIAARDRHVPLGRMATIHEAGSVIAFLASPAASWVTGATIP
VDGGITAAGGWHRSETGNWQLAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory