SitesBLAST
Comparing Ga0059261_2858 FitnessBrowser__Korea:Ga0059261_2858 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
40% identity, 98% coverage: 4:259/260 of query aligns to 4:256/257 of 6slbAAA
- active site: Q64 (≠ G64), F69 (≠ T69), L80 (≠ K81), N84 (≠ Q88), A108 (= A112), S111 (= S115), A130 (≠ S134), F131 (= F135), L136 (= L140), P138 (≠ A142), D139 (= D143), A224 (≠ H227), G234 (≠ A237)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ G58), A62 (≠ S62), Q64 (≠ G64), D65 (≠ Q65), L66 (= L66), Y76 (≠ A77), A108 (= A112), F131 (= F135), D139 (= D143)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
39% identity, 98% coverage: 4:259/260 of query aligns to 1:244/245 of 6slaAAA
- active site: Q61 (≠ G64), L68 (≠ I84), N72 (≠ Q88), A96 (= A112), S99 (= S115), A118 (≠ S134), F119 (= F135), L124 (= L140), P126 (≠ A142), N127 (≠ D143), A212 (≠ H227), G222 (≠ A237)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R24), A59 (≠ S62), Q61 (≠ G64), D62 (≠ Q65), L63 (= L66), L68 (≠ I84), Y71 (≠ L87), A94 (≠ Y110), G95 (= G111), A96 (= A112), F119 (= F135), I122 (= I138), L124 (= L140), N127 (≠ D143), F234 (= F249), K237 (= K252)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
34% identity, 99% coverage: 3:259/260 of query aligns to 4:258/259 of 5zaiC
- active site: A65 (≠ G64), F70 (≠ T69), S82 (≠ K81), R86 (≠ A85), G110 (≠ A112), E113 (≠ S115), P132 (≠ S134), E133 (≠ F135), I138 (≠ L140), P140 (≠ A142), G141 (≠ D143), A226 (≠ H227), F236 (≠ A237)
- binding coenzyme a: K24 (≠ L23), L25 (≠ R24), A63 (≠ S62), G64 (= G63), A65 (≠ G64), D66 (≠ Q65), I67 (≠ L66), P132 (≠ S134), R166 (≠ V168), F248 (= F249), K251 (= K252)
O53561 Enoyl-CoA hydratase EchA19; EC 4.2.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
37% identity, 95% coverage: 13:258/260 of query aligns to 18:264/266 of O53561
- K135 (≠ R130) modified: N6-succinyllysine; mutation to E: Nearly wild-type levels of succinylation in vitro, reduces specific activity 8-fold.
- 135:142 (vs. 130:137, 38% identical) mutation to EFGISEAE: Very low levels of succinylation in vitro, reduces specific activity 15-fold.
- K142 (= K137) modified: N6-succinyllysine; mutation to E: About 50% succinylation in vitro, reduces specific activity 7-fold.
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
36% identity, 95% coverage: 13:259/260 of query aligns to 15:260/261 of 5jbxB
- active site: A67 (≠ G64), R72 (≠ N70), L84 (= L87), R88 (≠ V91), G112 (≠ A112), E115 (≠ S115), T134 (≠ S134), E135 (≠ F135), I140 (≠ L140), P142 (≠ A142), G143 (≠ D143), A228 (≠ H227), L238 (≠ A237)
- binding coenzyme a: S24 (≠ Q22), R25 (≠ L23), R26 (= R24), A28 (= A26), A65 (≠ S62), D68 (≠ Q65), L69 (= L66), K70 (≠ Q67), L110 (≠ Y110), G111 (= G111), T134 (≠ S134), E135 (≠ F135), L138 (≠ I138), R168 (≠ V168)
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
38% identity, 77% coverage: 3:202/260 of query aligns to 1:182/224 of 3p85A
- active site: L62 (≠ G64), L67 (= L87), P68 (≠ Q88), G92 (≠ A112), E95 (≠ S115), T114 (≠ S134), H115 (≠ F135), L120 (= L140), P122 (≠ A142), T123 (≠ D143)
- binding calcium ion: D43 (≠ N45), D45 (= D47)
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
33% identity, 95% coverage: 11:257/260 of query aligns to 21:266/273 of Q5HH38
- R34 (= R24) binding in other chain
- SGGDQ 73:77 (≠ SGG-Q 62:65) binding in other chain
- S149 (≠ L140) binding in other chain
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
34% identity, 98% coverage: 3:257/260 of query aligns to 3:253/256 of 3h81A
- active site: A64 (≠ G64), M69 (≠ T69), T79 (= T80), F83 (≠ I84), G107 (≠ A112), E110 (≠ S115), P129 (≠ S134), E130 (≠ F135), V135 (≠ L140), P137 (≠ A142), G138 (≠ D143), L223 (≠ H227), F233 (≠ A237)
- binding calcium ion: F233 (≠ A237), Q238 (≠ Y242)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
34% identity, 98% coverage: 3:257/260 of query aligns to 4:254/255 of 3q0jC
- active site: A65 (≠ G64), M70 (≠ T69), T80 (= T80), F84 (≠ I84), G108 (≠ A112), E111 (≠ S115), P130 (≠ S134), E131 (≠ F135), V136 (≠ L140), P138 (≠ A142), G139 (≠ D143), L224 (≠ H227), F234 (≠ A237)
- binding acetoacetyl-coenzyme a: Q23 (= Q22), A24 (≠ L23), L25 (≠ R24), A27 (= A26), A63 (≠ S62), G64 (= G63), A65 (≠ G64), D66 (≠ Q65), I67 (≠ L66), K68 (≠ Q67), M70 (≠ T69), F84 (≠ I84), G107 (= G111), G108 (≠ A112), E111 (≠ S115), P130 (≠ S134), E131 (≠ F135), P138 (≠ A142), G139 (≠ D143), M140 (≠ A144)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
34% identity, 98% coverage: 3:257/260 of query aligns to 4:254/255 of 3q0gC
- active site: A65 (≠ G64), M70 (≠ T69), T80 (= T80), F84 (≠ I84), G108 (≠ A112), E111 (≠ S115), P130 (≠ S134), E131 (≠ F135), V136 (≠ L140), P138 (≠ A142), G139 (≠ D143), L224 (≠ H227), F234 (≠ A237)
- binding coenzyme a: L25 (≠ R24), A63 (≠ S62), I67 (≠ L66), K68 (≠ Q67), Y104 (= Y108), P130 (≠ S134), E131 (≠ F135), L134 (≠ I138)
5du6A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk059a. (see paper)
35% identity, 97% coverage: 9:260/260 of query aligns to 7:242/242 of 5du6A
- active site: A61 (≠ G64), P71 (≠ A77), I75 (≠ Q88), A99 (= A112), Q102 (≠ S115), P121 (≠ S134), T122 (≠ F135), L127 (= L140), L129 (≠ A142), D130 (= D143), P209 (≠ H227), W219 (≠ A237)
- binding (5R,7R)-5-(4-ethylphenyl)-N-(4-fluorobenzyl)-7-methyl-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L74 (= L87), D82 (≠ S95), D130 (= D143), W132 (≠ G145), A207 (≠ V225), K212 (≠ S230), F215 (≠ Q233)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
33% identity, 98% coverage: 3:257/260 of query aligns to 3:249/250 of 3q0gD
- active site: A64 (≠ G64), M69 (≠ T69), T75 (≠ A74), F79 (≠ Q78), G103 (≠ A112), E106 (≠ S115), P125 (≠ S134), E126 (≠ F135), V131 (≠ L140), P133 (≠ A142), G134 (≠ D143), L219 (≠ H227), F229 (≠ A237)
- binding Butyryl Coenzyme A: F225 (≠ Q233), F241 (= F249)
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
32% identity, 95% coverage: 11:257/260 of query aligns to 16:253/260 of 2uzfA
- active site: G70 (= G64), R80 (≠ K81), L84 (≠ A85), G108 (≠ A112), V111 (≠ S115), T130 (≠ S134), G131 (≠ F135), S136 (≠ L140), D138 (= D143), A139 (= A144), A225 (≠ E229), Y233 (≠ A237)
- binding acetoacetyl-coenzyme a: V28 (≠ L23), R29 (= R24), S68 (= S62), G69 (= G63), G70 (= G64), D71 (≠ Q65), Y104 (= Y108), G108 (≠ A112)
5dufA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk729a (see paper)
35% identity, 100% coverage: 2:260/260 of query aligns to 1:245/245 of 5dufA
- active site: A62 (≠ G64), D67 (≠ T69), P74 (= P75), I78 (≠ Q88), A102 (= A112), Q105 (≠ S115), P124 (≠ S134), T125 (≠ F135), L130 (= L140), L132 (≠ A142), D133 (= D143), P212 (≠ H227), W222 (≠ A237)
- binding (5R,7S)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxylic acid: L77 (= L87), I78 (≠ Q88), H81 (≠ V91), D85 (≠ S95), Q105 (≠ S115), D133 (= D143), W135 (≠ G145)
5ducA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk951a (see paper)
35% identity, 97% coverage: 9:260/260 of query aligns to 7:244/244 of 5ducA
- active site: A61 (≠ G64), D66 (≠ T69), P73 (= P75), I77 (≠ Q88), A101 (= A112), Q104 (≠ S115), P123 (≠ S134), T124 (≠ F135), L129 (= L140), L131 (≠ A142), D132 (= D143), P211 (≠ H227), W221 (≠ A237)
- binding (5R,7S)-N-(1,3-benzodioxol-5-ylmethyl)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (= L87), H80 (≠ V91), D84 (≠ S95), Q104 (≠ S115), D132 (= D143), W134 (≠ G145), F217 (≠ Q233)
5du4A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk366a (see paper)
35% identity, 97% coverage: 9:260/260 of query aligns to 7:244/244 of 5du4A
- active site: A61 (≠ G64), D66 (≠ T69), P73 (= P75), I77 (≠ Q88), A101 (= A112), Q104 (≠ S115), P123 (≠ S134), T124 (≠ F135), L129 (= L140), L131 (≠ A142), D132 (= D143), P211 (≠ H227), W221 (≠ A237)
- binding (5R,7S)-5-(4-ethylphenyl)-N-(4-methoxybenzyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (= L87), I77 (≠ Q88), H80 (≠ V91), D84 (≠ S95), Q104 (≠ S115), D132 (= D143), W134 (≠ G145)
5dtwA Crystal structure of m. Tuberculosis echa6 bound to c20-coa (see paper)
35% identity, 97% coverage: 9:260/260 of query aligns to 7:244/244 of 5dtwA
- active site: A61 (≠ G64), D66 (≠ T69), P73 (= P75), I77 (≠ Q88), A101 (= A112), Q104 (≠ S115), P123 (≠ S134), T124 (≠ F135), L129 (= L140), L131 (≠ A142), D132 (= D143), P211 (≠ H227), W221 (≠ A237)
- binding Arachinoyl-CoA: R18 (≠ V20), E20 (≠ Q22), R21 (≠ L23), R21 (≠ L23), R22 (= R24), A24 (= A26), A59 (≠ S62), A61 (≠ G64), D62 (≠ Q65), L63 (= L66), H80 (≠ V91), D84 (≠ S95), G100 (= G111), A101 (= A112), Y127 (≠ I138), W134 (≠ G145)
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 95% coverage: 10:257/260 of query aligns to 84:330/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
5du8A Crystal structure of m. Tuberculosis echa6 bound to gsk572a (see paper)
35% identity, 96% coverage: 11:260/260 of query aligns to 9:234/234 of 5du8A
- active site: A61 (= A73), P63 (= P75), I67 (≠ Q88), A91 (= A112), Q94 (≠ S115), P113 (≠ S134), T114 (≠ F135), L119 (= L140), L121 (≠ A142), D122 (= D143), P201 (≠ H227), W211 (≠ A237)
- binding (5R,7S)-5-(4-ethylphenyl)-N-[(5-fluoropyridin-2-yl)methyl]-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L66 (= L87), I67 (≠ Q88), H70 (≠ V91), Q94 (≠ S115), D122 (= D143), W124 (≠ G145), F207 (≠ Q233)
Q9P4U9 Enoyl-CoA hydratase AKT3-1; AF-toxin biosynthesis protein 3-1; EC 4.2.1.17 from Alternaria alternata (Alternaria rot fungus) (Torula alternata) (see paper)
33% identity, 96% coverage: 9:258/260 of query aligns to 21:269/296 of Q9P4U9
Sites not aligning to the query:
- 294:296 Peroxisomal targeting signal type 1
Query Sequence
>Ga0059261_2858 FitnessBrowser__Korea:Ga0059261_2858
MSEFILQREQDGVVVLTLNVPQLRNAISLEMREALLGHLREAGNNPDIRAVVLTGAGGNF
CSGGQLQPTNGAAAPDAQRTKRNIAILQDIVRLLSGGPKPTIAAVEGYAYGAGMSLATAC
DVLVAGESARFCASFGKIGLMADAGMLWSLPQRVGPGRAREMMLTGRVVEAAEAGALGLA
NRVVPAGSALDAALEVAAGFAGIAPLAIAAMKRVMARGPNSLEDVLHAESDAQPVLALSQ
DYVEGRTAFKEKRAPMFRGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory