SitesBLAST
Comparing Ga0059261_2860 FitnessBrowser__Korea:Ga0059261_2860 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
26% identity, 81% coverage: 44:345/372 of query aligns to 45:355/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (= M333), T347 (≠ E337), E348 (= E338)
- binding flavin-adenine dinucleotide: F125 (≠ L118), L127 (≠ A120), S128 (≠ G121), G133 (≠ L126), S134 (≠ R127), W158 (≠ V151), T160 (≠ I153), R270 (= R259), F273 (≠ Y262), L280 (≠ F269), V282 (= V271), Q338 (= Q328), I339 (≠ L329), G342 (= G332)
Sites not aligning to the query:
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
26% identity, 91% coverage: 7:345/372 of query aligns to 36:382/412 of P16219
- G90 (= G62) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (≠ R76) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 118:127, 10% identical) binding in other chain
- R171 (≠ A137) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ VVI 151:153) binding in other chain
- A192 (= A158) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G176) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R259) binding
- Q308 (= Q270) binding in other chain
- R325 (= R287) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ G316) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QLHGG 328:332) binding
- R380 (≠ H343) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 394:396 binding in other chain
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
26% identity, 81% coverage: 44:345/372 of query aligns to 48:358/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ L118), L130 (≠ A120), S131 (≠ G121), G136 (≠ L126), S137 (≠ R127), W161 (≠ V151), T163 (≠ I153), T214 (≠ A200), R273 (= R259), F276 (≠ Y262), L280 (= L266), L283 (≠ F269), V285 (= V271), Q341 (= Q328), I342 (≠ L329), G345 (= G332)
Sites not aligning to the query:
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
26% identity, 81% coverage: 44:345/372 of query aligns to 42:352/381 of 8sgsA
- binding coenzyme a: S131 (≠ R127), A133 (= A129), N177 (≠ D173), F231 (≠ V223), M235 (≠ E227), L238 (= L230), I312 (≠ A305)
- binding flavin-adenine dinucleotide: F122 (≠ L118), L124 (≠ A120), S125 (≠ G121), G130 (≠ L126), S131 (≠ R127), W155 (≠ V151), T157 (≠ I153), R267 (= R259), F270 (≠ Y262), L274 (= L266), L277 (≠ F269), Q335 (= Q328), I336 (≠ L329), G338 (= G331), G339 (= G332)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
26% identity, 95% coverage: 1:355/372 of query aligns to 1:362/380 of 4l1fA
- active site: L125 (= L118), T126 (≠ A119), G242 (= G233)
- binding coenzyme a persulfide: T132 (≠ V125), H179 (≠ R174), F232 (≠ V223), M236 (≠ E227), E237 (≠ L228), L239 (= L230), D240 (= D231), R243 (≠ I234), Y362 (≠ F355)
- binding flavin-adenine dinucleotide: F123 (≠ L116), L125 (= L118), T126 (≠ A119), G131 (≠ H124), T132 (≠ V125), F156 (≠ V151), I157 (≠ V152), T158 (≠ I153), R268 (= R259), Q270 (= Q261), F271 (≠ Y262), I275 (≠ L266), F278 (= F269), L281 (= L272), Q336 (= Q328), I337 (≠ L329), G340 (= G332), I358 (≠ L351), Y362 (≠ F355)
- binding 1,3-propandiol: L5 (≠ Y5), Q10 (= Q10)
Sites not aligning to the query:
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
28% identity, 98% coverage: 1:365/372 of query aligns to 1:354/364 of 6wy8C
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
30% identity, 87% coverage: 42:365/372 of query aligns to 40:351/361 of 6wy9B
Sites not aligning to the query:
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
26% identity, 82% coverage: 41:345/372 of query aligns to 39:352/379 of 6fahD
- active site: L124 (≠ A120), T125 (≠ G121), G241 (= G233)
- binding flavin-adenine dinucleotide: F122 (≠ L118), L124 (≠ A120), T125 (≠ G121), R152 (= R148), F155 (≠ V151), T157 (≠ I153), E198 (≠ S191), R267 (= R259), Q269 (= Q261), F270 (≠ Y262), I274 (≠ L266), F277 (= F269), Q335 (= Q328), I336 (≠ L329), G339 (= G332)
Sites not aligning to the query:
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
25% identity, 91% coverage: 7:345/372 of query aligns to 3:342/371 of 2vigB
- active site: L121 (≠ A120), S122 (≠ G121), G231 (= G233)
- binding coenzyme a persulfide: S128 (≠ R127), F221 (≠ V223), M225 (≠ E227), Q226 (≠ L228), L228 (= L230), D229 (= D231), R232 (≠ I234)
- binding flavin-adenine dinucleotide: L121 (≠ A120), S122 (≠ G121), G127 (≠ L126), S128 (≠ R127), W152 (≠ V151), T154 (≠ I153), R257 (= R259), F260 (≠ Y262), L264 (= L266), L267 (≠ F269), Q325 (= Q328), I326 (≠ L329), G329 (= G332)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 81% coverage: 44:345/372 of query aligns to 72:382/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 392 active site, Proton acceptor
- 394:396 binding
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
25% identity, 81% coverage: 44:345/372 of query aligns to 45:355/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (≠ I91), F125 (≠ L118), S134 (≠ R127), F234 (≠ V223), M238 (≠ E227), Q239 (≠ L228), L241 (= L230), D242 (= D231), R245 (≠ I234)
- binding flavin-adenine dinucleotide: F125 (≠ L118), L127 (≠ A120), S128 (≠ G121), G133 (≠ L126), S134 (≠ R127), W158 (≠ V151), T160 (≠ I153), R270 (= R259), F273 (≠ Y262), L280 (≠ F269), Q338 (= Q328), I339 (≠ L329), G342 (= G332)
Sites not aligning to the query:
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
23% identity, 90% coverage: 7:342/372 of query aligns to 14:361/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ G121), G140 (≠ L126), S141 (≠ R127), W165 (≠ V151), T167 (≠ I153), R279 (= R259), F282 (≠ Y262), I286 (≠ L266), F289 (= F269), Q347 (= Q328), C348 (≠ L329), G351 (= G332)
Sites not aligning to the query:
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
23% identity, 90% coverage: 7:342/372 of query aligns to 47:394/426 of P26440
- 165:174 (vs. 118:127, 20% identical) binding
- S174 (≠ R127) binding
- WIT 198:200 (≠ VVI 151:153) binding
- SR 222:223 (≠ RD 174:175) binding
- G250 (vs. gap) to A: in IVA; uncertain significance
- Y277 (≠ A224) binding
- DLER 284:287 (≠ DHGI 231:234) binding
- E286 (≠ G233) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ C238) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R259) binding
- Q323 (= Q270) binding
- I379 (≠ V327) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QLHGG 328:332) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 398 R → Q: in IVA; uncertain significance; dbSNP:rs1477527791
- 403 Y → N: in IVA; uncertain significance
- 407 A→E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- 407:408 binding
- 409:411 binding
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
23% identity, 90% coverage: 7:342/372 of query aligns to 10:357/387 of 1ivhA
- active site: M130 (≠ A120), S131 (≠ G121), E249 (≠ G233)
- binding coenzyme a persulfide: S137 (≠ R127), S185 (≠ R174), R186 (≠ D175), V239 (= V223), Y240 (≠ A224), M243 (≠ E227), E249 (≠ G233), R250 (≠ I234)
- binding flavin-adenine dinucleotide: L128 (= L118), M130 (≠ A120), S131 (≠ G121), G136 (≠ L126), S137 (≠ R127), W161 (≠ V151), T163 (≠ I153), R275 (= R259), F278 (≠ Y262), F285 (= F269), M288 (≠ L272), Q343 (= Q328), C344 (≠ L329), G347 (= G332)
Sites not aligning to the query:
4x28D Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
25% identity, 98% coverage: 1:365/372 of query aligns to 1:355/364 of 4x28D
Sites not aligning to the query:
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
27% identity, 95% coverage: 1:355/372 of query aligns to 1:366/383 of 1bucA
- active site: L128 (≠ A120), T129 (≠ G121), G246 (= G233)
- binding acetoacetyl-coenzyme a: L96 (vs. gap), F126 (≠ L118), G134 (≠ L126), T135 (≠ R127), T162 (≠ I153), N182 (≠ D173), H183 (≠ R174), F236 (≠ V223), M240 (≠ E227), M241 (≠ L228), L243 (= L230), D244 (= D231), T317 (≠ R304), Y366 (≠ F355)
- binding flavin-adenine dinucleotide: F126 (≠ L118), L128 (≠ A120), T129 (≠ G121), G134 (≠ L126), T135 (≠ R127), F160 (≠ V151), T162 (≠ I153), Y366 (≠ F355)
Sites not aligning to the query:
Q06319 Acyl-CoA dehydrogenase, short-chain specific; Butyryl-CoA dehydrogenase; BCAD; SCAD; EC 1.3.8.1 from Megasphaera elsdenii (see paper)
27% identity, 95% coverage: 1:355/372 of query aligns to 1:366/383 of Q06319
Sites not aligning to the query:
- 367 active site, Proton acceptor; E→Q: Loss of activity.
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
25% identity, 93% coverage: 1:345/372 of query aligns to 2:354/378 of 4n5fA
Sites not aligning to the query:
4ktoA Crystal structure of a putative isovaleryl-coa dehydrogenase (psi- nysgrc-012251) from sinorhizobium meliloti 1021
28% identity, 65% coverage: 41:281/372 of query aligns to 45:287/377 of 4ktoA
- active site: M130 (≠ A120), S131 (≠ G121), E239 (≠ G233)
- binding flavin-adenine dinucleotide: L128 (= L118), M130 (≠ A120), S131 (≠ G121), M155 (≠ P150), W156 (≠ V151), T158 (≠ I153), R265 (= R259), F268 (≠ Y262), I272 (≠ L266), F275 (= F269), M278 (≠ L272)
Sites not aligning to the query:
I6Y3Q0 Acyl-CoA dehydrogenase FadE27; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
24% identity, 98% coverage: 1:365/372 of query aligns to 1:364/373 of I6Y3Q0
- R251 (= R259) binding
- H327 (≠ Q328) binding
- G331 (= G332) binding
Query Sequence
>Ga0059261_2860 FitnessBrowser__Korea:Ga0059261_2860
MDFHYDDNQQMLHDTVDRFLTDKYNLVTRHKLLGDLEGQAQLWREMAELGLIGAAFPEGV
GGYGASPVDALVVMERFGRHLVTLPYLMTAIVCGRLLIAGGRTDMIERVIAGDARLALAA
GSTHVLRSAEHHSFTAAAAGAGWTIRGRMPVVIGGDSADTFIVAARTSGALGDRDGITLF
LVDADQVARRSFRMIDAHGAAEVVIDALSVGEDAVLSEIGGGVALVELALDHGIAAACGE
AIGSMGHLVPATAEYTRTREQYGAPLAKFQVLQHRMADMYIQTETARSMAYVASMSLGDT
PVERARIVSAAKVQIGKSGKFVGYQAVQLHGGMGVSEELDIGHHYIRLNTLNQMFGDPAF
HLRRFAAAGAPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory