SitesBLAST
Comparing Ga0059261_2882 FitnessBrowser__Korea:Ga0059261_2882 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4b79A The aeropath project and pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery. (see paper)
46% identity, 98% coverage: 3:237/240 of query aligns to 8:233/236 of 4b79A
- active site: G21 (= G16), S133 (= S133), R143 (≠ A143), Y146 (= Y146), K150 (= K150)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S19 (≠ I14), S20 (≠ G15), G21 (= G16), I22 (= I17), L42 (≠ Y37), L60 (= L59), D61 (= D60), I62 (≠ V61), N84 (≠ C83), G86 (= G85), L105 (≠ V105), I131 (= I131), Y146 (= Y146), K150 (= K150), P176 (= P176), G177 (= G177), I179 (= I179), T181 (= T181)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 98% coverage: 1:236/240 of query aligns to 4:239/243 of 4i08A
- active site: G19 (= G16), N113 (= N106), S141 (= S133), Q151 (≠ A143), Y154 (= Y146), K158 (= K150)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ I14), R18 (≠ G15), I20 (= I17), T40 (≠ Y37), N62 (≠ D60), V63 (= V61), N89 (≠ C83), A90 (= A84), G140 (≠ A132), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), G185 (= G177), T189 (= T181)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
41% identity, 100% coverage: 1:239/240 of query aligns to 2:252/258 of 4wecA
- active site: G21 (= G16), S143 (= S133), Q154 (≠ P144), Y157 (= Y146), K161 (= K150)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (≠ I14), S20 (≠ G15), G21 (= G16), I22 (= I17), D41 (≠ G36), I42 (≠ Y37), V61 (≠ L59), D62 (= D60), V63 (= V61), N89 (≠ C83), T141 (≠ I131), Y157 (= Y146), K161 (= K150), P187 (= P176), P189 (≠ W178), V190 (≠ I179)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
37% identity, 98% coverage: 1:236/240 of query aligns to 4:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), S17 (≠ I14), R18 (≠ G15), I20 (= I17), T40 (≠ Y37), N62 (≠ D60), V63 (= V61), N89 (≠ C83), A90 (= A84), I92 (≠ T86), V139 (≠ I131), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), G185 (= G177), I187 (= I179), T189 (= T181), M191 (≠ L183)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
37% identity, 98% coverage: 3:236/240 of query aligns to 9:245/254 of 3o03A
- active site: G22 (= G16), S147 (= S133), V157 (≠ A143), Y160 (= Y146), K164 (= K150)
- binding calcium ion: S147 (= S133), M148 (= M134), P190 (= P176)
- binding D-gluconic acid: I99 (≠ T87), R101 (= R89), S147 (= S133), M149 (= M135), R154 (≠ S140), Y160 (= Y146)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), Y21 (≠ G15), G22 (= G16), I23 (= I17), D42 (≠ G36), I43 (≠ Y37), L47 (≠ E41), D68 (= D60), V69 (= V61), N95 (≠ C83), A96 (= A84), G97 (= G85), I145 (= I131), Y160 (= Y146), K164 (= K150), P190 (= P176)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 100% coverage: 1:239/240 of query aligns to 3:254/255 of 5itvA
- active site: G18 (= G16), S141 (= S133), Y154 (= Y146), K158 (= K150)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (≠ G15), G18 (= G16), I19 (= I17), D38 (≠ G36), I39 (≠ Y37), T61 (≠ L59), I63 (≠ V61), N89 (≠ C83), G91 (= G85), T139 (≠ I131), S141 (= S133), Y154 (= Y146), K158 (= K150), P184 (= P176), G185 (= G177), I186 (≠ W178), I187 (= I179)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
40% identity, 98% coverage: 3:237/240 of query aligns to 6:243/246 of 4hp8B
- active site: G19 (= G16), S138 (= S133), V148 (≠ A143), Y151 (= Y146), K155 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), N17 (≠ I14), T18 (≠ G15), G19 (= G16), L20 (≠ I17), R40 (≠ Y37), R41 (≠ D38), D63 (= D60), F64 (≠ V61), N85 (≠ C83), G87 (= G85), I88 (≠ T86), I136 (= I131), Y151 (= Y146), K155 (= K150), P181 (= P176), G182 (= G177), I184 (= I179), T186 (= T181), N188 (≠ L183), T189 (= T184)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
42% identity, 99% coverage: 3:239/240 of query aligns to 3:238/240 of 2d1yA
- active site: G16 (= G16), S135 (= S133), N145 (≠ A143), Y148 (= Y146), K152 (= K150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (≠ G15), I17 (= I17), D36 (≠ G36), L37 (≠ Y37), R38 (vs. gap), V55 (≠ L59), D56 (= D60), L57 (≠ V61), N83 (≠ C83), A84 (= A84), A85 (≠ G85), I86 (≠ T86), V133 (≠ I131), S135 (= S133), Y148 (= Y146), K152 (= K150), P178 (= P176), G179 (= G177), I181 (= I179), T183 (= T184), A185 (≠ R186), V186 (≠ Q187)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
39% identity, 97% coverage: 8:240/240 of query aligns to 5:250/250 of 2cfcA
- active site: G13 (= G16), S142 (= S133), Y155 (= Y146), K159 (= K150)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ S140), R152 (≠ A143), Y155 (= Y146), W195 (≠ R186), R196 (≠ Q187)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), S12 (≠ G15), G13 (= G16), N14 (≠ I17), D33 (≠ G36), L34 (≠ Y37), A59 (≠ L59), D60 (= D60), V61 (= V61), N87 (≠ C83), A88 (= A84), G89 (= G85), I140 (= I131), P185 (= P176), G186 (= G177), M187 (≠ W178), I188 (= I179), T190 (= T181), P191 (= P182), M192 (≠ L183), T193 (= T184)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
39% identity, 97% coverage: 8:240/240 of query aligns to 5:250/250 of Q56840
- SGN 12:14 (≠ GGI 15:17) binding
- D33 (≠ G36) binding
- DV 60:61 (= DV 60:61) binding
- N87 (≠ C83) binding
- S142 (= S133) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ A143) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y146) mutation Y->E,F: Loss of activity.
- K159 (= K150) mutation to A: Loss of activity.
- R179 (= R170) mutation to A: Loss of activity.
- IETPM 188:192 (≠ IVTPL 179:183) binding
- WR 195:196 (≠ RQ 186:187) binding
- R196 (≠ Q187) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R193) mutation to A: Slight decrease in catalytic efficiency.
- R209 (= R199) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
38% identity, 98% coverage: 1:236/240 of query aligns to 3:241/245 of 5t5qC
- active site: G18 (= G16), S140 (= S133), N150 (≠ A143), Y153 (= Y146), K157 (= K150)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ I14), G17 (= G15), G18 (= G16), I19 (= I17), D38 (≠ G36), L39 (≠ Y37), D63 (= D60), A64 (≠ V61), S90 (≠ C83), I113 (≠ V105), Y153 (= Y146), K157 (= K150), P182 (= P176), I185 (= I179), T187 (= T181), M189 (≠ L183)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 98% coverage: 1:236/240 of query aligns to 1:244/247 of 4jroC
- active site: G16 (= G16), S142 (= S133), Q152 (≠ A143), Y155 (= Y146), K159 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ I14), R15 (≠ G15), G16 (= G16), I17 (= I17), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (vs. gap), N63 (≠ G53), V64 (≠ I54), N90 (≠ C83), A91 (= A84), I93 (≠ T86), I113 (≠ V105), S142 (= S133), Y155 (= Y146), K159 (= K150), P185 (= P176), I188 (= I179), T190 (= T181)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 100% coverage: 1:240/240 of query aligns to 1:244/244 of P0AEK2
- GASR 12:15 (≠ GGIG 12:15) binding
- T37 (≠ Y37) binding
- NV 59:60 (≠ DV 60:61) binding
- N86 (≠ C83) binding
- Y151 (= Y146) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAASK 146:150) binding
- A154 (≠ S149) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K150) mutation to A: Defect in the affinity for NADPH.
- I184 (= I179) binding
- E233 (≠ V229) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 100% coverage: 1:239/240 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G16), S143 (= S133), I154 (vs. gap), Y157 (= Y146), K161 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), R16 (≠ G15), G17 (= G16), L18 (≠ I17), S37 (≠ G36), R38 (≠ Y37), C63 (≠ L59), D64 (= D60), V65 (= V61), A91 (≠ C83), A92 (= A84), G93 (= G85), I94 (≠ T86), V114 (= V105), I141 (= I131), S143 (= S133), Y157 (= Y146), K161 (= K150), P187 (= P176), G188 (= G177), Y190 (≠ I179), T192 (= T181), M194 (≠ L183), T195 (= T184)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
42% identity, 98% coverage: 5:238/240 of query aligns to 11:252/254 of 3lqfA
- active site: G22 (= G16), S144 (= S133), Y159 (= Y146), K163 (= K150)
- binding meso-erythritol: N151 (vs. gap), Y159 (= Y146), Y191 (≠ W178), T197 (= T184), M200 (≠ Q187)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (≠ G15), G22 (= G16), I23 (= I17), D42 (≠ G36), R43 (≠ Y37), D66 (= D60), V67 (= V61), S92 (≠ C83), L142 (≠ I131), S144 (= S133), K163 (= K150), P189 (= P176), V192 (≠ I179), T194 (= T181), M196 (≠ L183), T197 (= T184)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
42% identity, 98% coverage: 5:238/240 of query aligns to 11:252/254 of 2wsbA
- active site: G22 (= G16), S144 (= S133), Y159 (= Y146), K163 (= K150)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (≠ G15), G22 (= G16), I23 (= I17), D42 (≠ G36), R43 (≠ Y37), D66 (= D60), V67 (= V61), S92 (≠ C83), A93 (= A84), L142 (≠ I131), S144 (= S133), Y159 (= Y146), K163 (= K150), P189 (= P176), V192 (≠ I179), T194 (= T181), M196 (≠ L183), T197 (= T184)
- binding n-propanol: S144 (= S133), M145 (= M134), N151 (vs. gap), N151 (vs. gap), Y159 (= Y146), Y159 (= Y146), Y191 (≠ W178)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
42% identity, 98% coverage: 5:238/240 of query aligns to 11:252/254 of 2wdzA
- active site: G22 (= G16), S144 (= S133), Y159 (= Y146), K163 (= K150)
- binding (2S)-pentane-1,2-diol: A45 (≠ Q39), D49 (= D43), R62 (≠ M56), S146 (= S140), Y159 (= Y146)
- binding nicotinamide-adenine-dinucleotide: G18 (= G12), S21 (≠ G15), G22 (= G16), I23 (= I17), D42 (≠ G36), R43 (≠ Y37), A65 (≠ L59), D66 (= D60), V67 (= V61), S92 (≠ C83), A93 (= A84), L142 (≠ I131), S144 (= S133), Y159 (= Y146), K163 (= K150), P189 (= P176), V192 (≠ I179), T194 (= T181), M196 (≠ L183), T197 (= T184)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
42% identity, 98% coverage: 5:238/240 of query aligns to 11:252/254 of C0KTJ6
Sites not aligning to the query:
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 96% coverage: 6:236/240 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G16), N111 (= N106), S139 (= S133), Q149 (≠ A143), Y152 (= Y146), K156 (= K150)
- binding acetoacetyl-coenzyme a: D93 (≠ R89), K98 (≠ A93), S139 (= S133), N146 (≠ S140), V147 (≠ G141), Q149 (≠ A143), Y152 (= Y146), F184 (≠ W178), M189 (≠ L183), K200 (≠ R195)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ G15), G18 (= G16), I19 (= I17), D38 (≠ G36), F39 (≠ Y37), V59 (≠ L59), D60 (= D60), V61 (= V61), N87 (≠ C83), A88 (= A84), G89 (= G85), I90 (≠ T86), T137 (≠ I131), S139 (= S133), Y152 (= Y146), K156 (= K150), P182 (= P176), F184 (≠ W178), T185 (≠ I179), T187 (= T181), M189 (≠ L183)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 100% coverage: 1:240/240 of query aligns to 1:244/244 of 6t77A
- active site: G16 (= G16), S138 (= S133), Y151 (= Y146)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ I14), R15 (≠ G15), T37 (≠ Y37), L58 (= L59), N59 (≠ D60), V60 (= V61), A87 (= A84), G88 (= G85), I89 (≠ T86)
Query Sequence
>Ga0059261_2882 FitnessBrowser__Korea:Ga0059261_2882
MDFTGKRAVVTGGIGGIGGAISQALHAAGAEVVATGYDQAEVDARAGEAGFAGIAMKPLD
VSDDAAVRAFAEDTGGIDFLVNCAGTTARGHAAFEEEAFQHVLDVNLTGTMRCCRAFRPA
LAVRGGAIVNIASMMSLFGSGTAPGYAASKGGVALLTKSLAIAWAEQRIRVNAVAPGWIV
TPLTDRQIDPALRERVIGRTPMRRWGEPRHIADAVAFLCSDKASFITGVVLPVDGGYSSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory