Comparing Ga0059261_2965 FitnessBrowser__Korea:Ga0059261_2965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
35% identity, 97% coverage: 4:330/336 of query aligns to 7:329/329 of 2afbA
Sites not aligning to the query:
3ktnA Crystal structure of a putative 2-keto-3-deoxygluconate kinase from enterococcus faecalis
30% identity, 97% coverage: 4:329/336 of query aligns to 3:329/340 of 3ktnA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
34% identity, 87% coverage: 5:296/336 of query aligns to 4:268/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
34% identity, 87% coverage: 5:296/336 of query aligns to 4:268/300 of 1v1bA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
34% identity, 87% coverage: 5:296/336 of query aligns to 4:268/309 of Q53W83
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
24% identity, 93% coverage: 5:318/336 of query aligns to 3:296/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
24% identity, 93% coverage: 5:318/336 of query aligns to 4:297/313 of Q97U29
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
23% identity, 97% coverage: 4:328/336 of query aligns to 2:305/308 of 2dcnA
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
26% identity, 60% coverage: 5:205/336 of query aligns to 2:197/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
26% identity, 60% coverage: 5:205/336 of query aligns to 3:198/304 of 3ih0A
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
23% identity, 87% coverage: 4:294/336 of query aligns to 3:264/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
23% identity, 87% coverage: 4:294/336 of query aligns to 7:268/310 of 5yggA
Sites not aligning to the query:
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
28% identity, 73% coverage: 51:296/336 of query aligns to 60:283/306 of 4ebuA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 45% coverage: 34:184/336 of query aligns to 30:176/319 of Q8ZKR2
Sites not aligning to the query:
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
27% identity, 73% coverage: 51:296/336 of query aligns to 60:279/294 of 4eumA
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
25% identity, 45% coverage: 34:184/336 of query aligns to 26:165/297 of 1tz6A
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
25% identity, 45% coverage: 34:184/336 of query aligns to 26:165/299 of 1tz3A
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
27% identity, 76% coverage: 33:286/336 of query aligns to 24:237/282 of 7fcaD
>Ga0059261_2965 FitnessBrowser__Korea:Ga0059261_2965
MAGRIVCFGELLLRLTAPGRELLMQTPRLDVVVGGAEANVGIGLANLGHSVSMVSAVPDN
ALGRAAVQFVRSQGADTSGVQYRDGRMGLYFLTQGAGLRASDIVYDRADSAFANAPADAF
DWKTLLSGASMLHLSGITPALGPATAEAALRAARAAKELGVAISFDGNYRARLWEAWDSD
PRAVLTELVSLADTMFGNHRDVSLLLGKTFSGDGADRRREAAEAAFAAFPNLKRIASTAR
HVDDADRHRIAARVDTPERGYQTEEVVVAGIIDRIGGGDAYAAGILHGVLSGQDLEGTVA
SGLALTCLKHSLPGDASLFRQADIDAFLEGGLDVRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory