Comparing Ga0059261_2984 FitnessBrowser__Korea:Ga0059261_2984 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
48% identity, 97% coverage: 6:341/345 of query aligns to 3:351/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
48% identity, 96% coverage: 6:335/345 of query aligns to 6:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
47% identity, 97% coverage: 6:339/345 of query aligns to 5:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
45% identity, 94% coverage: 6:330/345 of query aligns to 5:320/320 of 7xntC
1t47A Structure of fe2-hppd bound to ntbc (see paper)
36% identity, 78% coverage: 66:335/345 of query aligns to 74:360/362 of 1t47A
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
29% identity, 94% coverage: 1:323/345 of query aligns to 286:611/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
29% identity, 94% coverage: 1:323/345 of query aligns to 284:614/635 of Q88JU3
Sites not aligning to the query:
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
35% identity, 57% coverage: 144:339/345 of query aligns to 175:379/393 of Q02110
Sites not aligning to the query:
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
29% identity, 88% coverage: 31:332/345 of query aligns to 25:339/343 of 3zgjB
7yvvA Acmp1, r-4-hydroxymandelate synthase
29% identity, 75% coverage: 73:332/345 of query aligns to 70:331/335 of 7yvvA
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 84% coverage: 50:339/345 of query aligns to 63:379/393 of P32755
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
30% identity, 83% coverage: 50:335/345 of query aligns to 45:344/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
30% identity, 83% coverage: 50:335/345 of query aligns to 46:346/357 of O52791
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
28% identity, 84% coverage: 50:339/345 of query aligns to 55:371/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
28% identity, 84% coverage: 50:339/345 of query aligns to 57:373/374 of 8im2A
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
27% identity, 83% coverage: 50:335/345 of query aligns to 57:369/371 of 8im3A
5ywhA Crystal structure of arabidopsis thaliana hppd complexed with y13508
30% identity, 79% coverage: 62:332/345 of query aligns to 89:370/372 of 5ywhA
5ywkA Crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl (see paper)
30% identity, 79% coverage: 62:332/345 of query aligns to 89:370/372 of 5ywkA
5yy6A Crystal structure of arabidopsis thaliana hppd truncated mutant complexed with benquitrione (see paper)
29% identity, 79% coverage: 62:332/345 of query aligns to 90:371/371 of 5yy6A
1sqdA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
29% identity, 78% coverage: 62:331/345 of query aligns to 90:373/373 of 1sqdA
>Ga0059261_2984 FitnessBrowser__Korea:Ga0059261_2984
MTDPANPLGLNGFEFVEFTSPDPAAMAAQFEQLGFVASHRHPTKNITRYKQGRINLMLNR
DDAGRVAKFRGEHGPSASAMAFRVADPVKAMEWALAHGAERTEEDDTVILGIGGSYLYFI
QDGHDLYENWAEIPGWQEAEAANNVGLDLLDHLTHNVRRGQMRVWSQFYKTLFGFEEQKY
FDIKGQATGLFSQAMIAPDKAIRIPLNESQDDKSQIEEFIREYKGEGIQHLALTTDDIYD
TVERLRARGVRLQDTIETYYELVDKRVPGHGEDLERLRKNRILIDGNVGEEGILLQIFTE
NMFGPIFFEIIQRKGNEGFGNGNFQALFESIELDQIRRGVIKVDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory