Comparing Ga0059261_3109 FitnessBrowser__Korea:Ga0059261_3109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3mqhA Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid (see paper)
70% identity, 95% coverage: 1:182/192 of query aligns to 2:183/191 of 3mqhA
3mqgC Crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with acetyl-coa (see paper)
70% identity, 95% coverage: 1:182/192 of query aligns to 3:184/192 of 3mqgC
G3XD01 UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronate N-acetyltransferase; UDP-D-GlcNAc3NA N-acetyltransferase; UDP-2-acetamido-3-amino-2,3-dideoxy-alpha-D-glucuronic acid 3-N-acetyltransferase; EC 2.3.1.201 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
68% identity, 97% coverage: 5:190/192 of query aligns to 6:189/191 of G3XD01
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
41% identity, 83% coverage: 4:163/192 of query aligns to 2:153/294 of 4mzuF
Sites not aligning to the query:
7s42A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- galactose (see paper)
46% identity, 71% coverage: 4:139/192 of query aligns to 4:137/145 of 7s42A
7s41A Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-acetamido-3,6-dideoxy-d- glucose (see paper)
46% identity, 71% coverage: 4:139/192 of query aligns to 4:137/145 of 7s41A
7s3wA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d- galactose (see paper)
46% identity, 71% coverage: 4:139/192 of query aligns to 4:137/145 of 7s3wA
7s3uA Crystal structure of an n-acetyltransferase from helicobacter pullorum in the presence of coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose (see paper)
46% identity, 71% coverage: 4:139/192 of query aligns to 4:137/145 of 7s3uA
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
41% identity, 85% coverage: 4:166/192 of query aligns to 2:154/290 of 4mzuB
Sites not aligning to the query:
7s45A Crystal structure of an n-acetyltransferase, c80t mutant, from helicobacter pullorum in the presence of acetyl coenzyme a and dtdp (see paper)
46% identity, 71% coverage: 4:139/192 of query aligns to 4:133/141 of 7s45A
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
32% identity, 76% coverage: 16:161/192 of query aligns to 89:229/260 of 3fsbA
Sites not aligning to the query:
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
32% identity, 76% coverage: 16:161/192 of query aligns to 89:229/259 of 3fscA
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d- glucose n-acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
32% identity, 76% coverage: 16:161/192 of query aligns to 89:229/259 of 3fs8A
Sites not aligning to the query:
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
30% identity, 54% coverage: 47:149/192 of query aligns to 72:179/190 of 5u2kA
P9WMN3 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
34% identity, 67% coverage: 14:142/192 of query aligns to 329:447/495 of P9WMN3
Sites not aligning to the query:
4k6rA Crystal structure of glmu in complex with atp (see paper)
34% identity, 67% coverage: 14:142/192 of query aligns to 324:442/469 of 4k6rA
Sites not aligning to the query:
3st8A Crystal structure of glmu from mycobacterium tuberculosis in complex with coenzyme a, glucosamine 1-phosphate and uridine-diphosphate-n- acetylglucosamine
34% identity, 67% coverage: 14:142/192 of query aligns to 324:442/475 of 3st8A
Sites not aligning to the query:
6ge9A Structure of mycobacterium tuberculosis glmu bound to glc-1p and ac- coa (see paper)
34% identity, 67% coverage: 14:142/192 of query aligns to 325:443/475 of 6ge9A
Sites not aligning to the query:
3sptA Crystal structure of glmu from mycobacterium tuberculosis in complex with acetyl coenzyme a and uridine-diphosphate-n-acetylglucosamine
34% identity, 67% coverage: 14:142/192 of query aligns to 324:442/474 of 3sptA
Sites not aligning to the query:
3d8vA Crystal structure of glmu from mycobacterium tuberculosis in complex with uridine-diphosphate-n-acetylglucosamine (see paper)
33% identity, 67% coverage: 14:142/192 of query aligns to 329:446/478 of 3d8vA
Sites not aligning to the query:
>Ga0059261_3109 FitnessBrowser__Korea:Ga0059261_3109
VATIHPTAIVDEGAQIGEGTRVWHWVHVSPGARIGAGCALGQNVYVGNDVTIGNNVRIQN
NVSVYDAVTLEDDVFCGPSMVFTNVYNPRSAVTRKDEYRRTLIRKGATLGANSTIVCGVV
VGESAFVGAGAVVNTDVKPFALMLGVPARQAGWMSAFGERIPLPLSGSGDYRCPHSGTLY
RLEGETLTVVIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory