Comparing Ga0059261_3115 FitnessBrowser__Korea:Ga0059261_3115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
41% identity, 59% coverage: 72:178/181 of query aligns to 78:187/188 of 3igjC
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
35% identity, 62% coverage: 64:176/181 of query aligns to 66:183/190 of 5u2kA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
37% identity, 63% coverage: 65:178/181 of query aligns to 73:185/186 of 4isxA
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 76% coverage: 40:176/181 of query aligns to 50:184/203 of P07464
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
30% identity, 76% coverage: 40:176/181 of query aligns to 49:183/200 of 1krrA
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
30% identity, 76% coverage: 40:176/181 of query aligns to 49:183/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
30% identity, 76% coverage: 40:176/181 of query aligns to 49:183/201 of 1kruA
Sites not aligning to the query:
4husA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with virginiamycin m1 (see paper)
42% identity, 33% coverage: 118:177/181 of query aligns to 103:166/212 of 4husA
Sites not aligning to the query:
4hurA Crystal structure of streptogramin group a antibiotic acetyltransferase vata from staphylococcus aureus in complex with acetyl coenzyme a (see paper)
42% identity, 33% coverage: 118:177/181 of query aligns to 103:166/211 of 4hurA
Sites not aligning to the query:
6x3jA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f0224 (46) (see paper)
42% identity, 33% coverage: 118:177/181 of query aligns to 103:166/206 of 6x3jA
Sites not aligning to the query:
6x3cA Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
42% identity, 33% coverage: 118:177/181 of query aligns to 103:166/207 of 6x3cA
Sites not aligning to the query:
6x3cE Crystal structure of streptogramin a acetyltransferase vata from staphylococcus aureus in complex with streptogramin analog f1037 (47) (see paper)
42% identity, 33% coverage: 118:177/181 of query aligns to 103:166/203 of 6x3cE
Sites not aligning to the query:
P50870 Streptogramin A acetyltransferase; Virginiamycin acetyltransferase D; Vat(D); EC 2.3.1.- from Enterococcus faecium (Streptococcus faecium) (see paper)
42% identity, 29% coverage: 126:177/181 of query aligns to 116:167/209 of P50870
Sites not aligning to the query:
1kk4A Crystal structure of vat(d) in complex with acetyl-coa (see paper)
42% identity, 29% coverage: 126:177/181 of query aligns to 116:167/205 of 1kk4A
Sites not aligning to the query:
3dhoA Structure of streptogramin acetyltransferase in complex with an inhibitor
42% identity, 29% coverage: 126:177/181 of query aligns to 116:167/203 of 3dhoA
Sites not aligning to the query:
1mrlA Crystal structure of streptogramin a acetyltransferase with dalfopristin (see paper)
42% identity, 29% coverage: 126:177/181 of query aligns to 116:167/204 of 1mrlA
Sites not aligning to the query:
1khrA Crystal structure of vat(d) in complex with virginiamycin and coenzyme a (see paper)
42% identity, 29% coverage: 126:177/181 of query aligns to 116:167/206 of 1khrA
Sites not aligning to the query:
Q97R46 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see 2 papers)
29% identity, 62% coverage: 70:181/181 of query aligns to 351:450/459 of Q97R46
Sites not aligning to the query:
4aawA S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
29% identity, 62% coverage: 70:181/181 of query aligns to 347:446/455 of 4aawA
Sites not aligning to the query:
4ac3A S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
29% identity, 62% coverage: 70:181/181 of query aligns to 348:447/456 of 4ac3A
Sites not aligning to the query:
>Ga0059261_3115 FitnessBrowser__Korea:Ga0059261_3115
MKALIKAAVRRTVDAVPFLRRRRDWGYGFIEWRVLLVNFLFQRIFRINGEAPWSVAFTSR
VIQPHNVTIGRNVGKSLAVSGCCYIQAINGIEIGDDTIFSFGVGIVSSNHEPGNLSESVK
DAPVRIGMNCWLGKNAIVLPGVELGDGCVVAAGAVVTRSFPPGTVVAGVPARPIEKREAA
S
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory