SitesBLAST
Comparing Ga0059261_3133 FitnessBrowser__Korea:Ga0059261_3133 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
84% identity, 100% coverage: 2:292/292 of query aligns to 1:288/288 of 2ux8G
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
75% identity, 100% coverage: 2:292/292 of query aligns to 1:255/255 of 2ux8A
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
49% identity, 98% coverage: 8:292/292 of query aligns to 7:287/290 of 5i1fA
- binding uridine-5'-diphosphate-glucose: P11 (= P12), A13 (≠ G14), G14 (= G15), K28 (= K29), E29 (= E30), Q106 (= Q105), A109 (≠ P108), L110 (≠ M109), G111 (= G110), L112 (= L111), A115 (= A114), D135 (= D134), Y172 (= Y174), G173 (= G175), E192 (= E194), K193 (= K195), V205 (= V207)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
47% identity, 94% coverage: 6:280/292 of query aligns to 3:272/282 of 5ve7A
- binding uridine 5'-triphosphate: P9 (= P12), V10 (= V13), A11 (≠ G14), G12 (= G15), G14 (= G17), T15 (= T18), R16 (= R19), K26 (= K29), E27 (= E30), Q104 (= Q105), A107 (≠ P108), G109 (= G110), A113 (= A114)
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
50% identity, 90% coverage: 6:269/292 of query aligns to 8:271/281 of 8f73E
- binding uridine-5'-diphosphate-glucose: P14 (= P12), A16 (≠ G14), G17 (= G15), K31 (= K29), E32 (= E30), Q108 (= Q105), G113 (= G110), L114 (= L111), A117 (= A114), L134 (= L131), D137 (= D134), E196 (= E194), K197 (= K195), I209 (≠ V207)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
45% identity, 98% coverage: 6:291/292 of query aligns to 2:287/290 of 6knlA
- binding triphosphate: G13 (= G17), T14 (= T18), R15 (= R19), K79 (≠ R83), K81 (= K85)
- binding uridine: P8 (= P12), G11 (= G15), K25 (= K29), Q103 (= Q105), P106 (= P108), G108 (= G110), P130 (≠ A132), D131 (= D133)
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
45% identity, 98% coverage: 6:291/292 of query aligns to 2:287/290 of 6k8dA
- binding uridine-5'-diphosphate-glucose: P8 (= P12), A10 (≠ G14), G11 (= G15), Q103 (= Q105), P106 (= P108), G108 (= G110), L109 (= L111), A112 (= A114), L129 (= L131), D131 (= D133), E193 (= E194), V206 (= V207)
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
43% identity, 93% coverage: 6:276/292 of query aligns to 2:264/265 of 3jukA
- binding uridine-5'-diphosphate-glucose: A10 (≠ G14), G11 (= G15), E26 (= E30), Q94 (= Q105), M97 (≠ P108), G99 (= G110), L100 (= L111), A103 (= A114), D123 (= D134), Y162 (= Y174), G163 (= G175), E182 (= E194), K183 (= K195), V195 (= V207)
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
43% identity, 93% coverage: 6:276/292 of query aligns to 2:264/264 of 3jukD
- binding magnesium ion: T14 (= T18), R15 (= R19)
- binding uridine-5'-diphosphate-glucose: P8 (= P12), A10 (≠ G14), G11 (= G15), E26 (= E30), Q94 (= Q105), M97 (≠ P108), G99 (= G110), L100 (= L111), A103 (= A114), L120 (= L131), D123 (= D134), Y162 (= Y174), G163 (= G175), E182 (= E194), K183 (= K195), V195 (= V207)
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
44% identity, 98% coverage: 6:291/292 of query aligns to 2:282/285 of 6ikzB
- binding uridine 5'-triphosphate: P8 (= P12), V9 (= V13), A10 (≠ G14), G11 (= G15), L12 (= L16), G13 (= G17), T14 (= T18), R15 (= R19), K25 (= K29), Q103 (= Q105), P106 (= P108), G108 (= G110), D131 (= D133)
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
40% identity, 98% coverage: 6:292/292 of query aligns to 3:291/299 of 2pa4B
- binding uridine-5'-diphosphate-glucose: P9 (= P12), A10 (≠ V13), A11 (≠ G14), G12 (= G15), E27 (= E30), Q103 (= Q105), P106 (= P108), G108 (= G110), L109 (= L111), L131 (= L131), P132 (≠ A132), D134 (= D134), Y170 (= Y174), G171 (= G175), E192 (= E194), K193 (= K195), A205 (≠ V207)
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
41% identity, 95% coverage: 9:286/292 of query aligns to 5:283/291 of 8b6dA
- binding uridine-5'-diphosphate: P8 (= P12), A10 (≠ G14), G11 (= G15), L12 (= L16), G13 (= G17), T14 (= T18), R15 (= R19), K25 (= K29), Q102 (= Q105), A105 (≠ P108), G107 (= G110), A111 (= A114)
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
39% identity, 95% coverage: 9:286/292 of query aligns to 5:278/286 of 8b68A
- binding uridine-5'-diphosphate-glucose: P8 (= P12), A10 (≠ G14), G11 (= G15), Q102 (= Q105), A105 (≠ P108), G107 (= G110), A111 (= A114), L130 (= L131), P131 (≠ A132), D133 (= D134), A203 (≠ V207), G205 (= G209)
P9WH13 Glucose-1-phosphate thymidylyltransferase; Glc-1-P thymidylyltransferase; dTDP-glucose pyrophosphorylase; dTDP-glucose synthase; EC 2.7.7.24 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
28% identity, 78% coverage: 8:236/292 of query aligns to 2:198/288 of P9WH13
- G8 (= G14) binding ; binding
- G11 (= G17) binding
- T12 (= T18) binding ; modified: Phosphothreonine; by PknB; mutation to A: Significant loss of phosphorylation. Lack of phosphorylation; when associated with A-54. Decreases activity and negatively affects cell wall formation.; mutation to D: Decreases activity and negatively affects cell wall formation. Attenuates virulence in a macrophage model with promoted cytokine production in host cells.
- R13 (= R19) binding
- K23 (= K29) binding ; binding
- Q24 (≠ E30) binding ; binding
- T54 (= T78) modified: Phosphothreonine; by PknB; mutation to A: Small decrease in phosphorylation. Lack of phosphorylation; when associated with A-12.
- Q80 (= Q105) binding ; binding
- G85 (= G110) binding ; binding
- D108 (= D133) binding ; binding ; binding
- N109 (≠ D134) binding
- G143 (= G175) binding
- E158 (= E194) binding
- K159 (= K195) binding
- V169 (= V207) binding
- T197 (= T235) modified: Phosphothreonine; by PknB; mutation to A: Small decrease in phosphorylation.
Sites not aligning to the query:
6b5eB Mycobacterium tuberculosis rmla in complex with dtdp-glucose (see paper)
28% identity, 78% coverage: 8:236/292 of query aligns to 2:198/286 of 6b5eB
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L6 (≠ P12), G8 (= G14), G9 (= G15), Q24 (≠ E30), Q80 (= Q105), P83 (= P108), G85 (= G110), L86 (= L111), L106 (= L131), G107 (≠ A132), D108 (= D133), G143 (= G175), E158 (= E194), K159 (= K195), V169 (= V207)
- binding magnesium ion: D108 (= D133)
- binding thymidine-5'-diphosphate: M43 (≠ E49), Y112 (≠ V137), G113 (≠ S138), P114 (≠ A139), G115 (≠ C145), G117 (≠ R147), T118 (≠ Q148), S119 (≠ M149)
Sites not aligning to the query:
6b5kA Mycobacterium tuberculosis rmla in complex with mg/dttp (see paper)
28% identity, 78% coverage: 8:236/292 of query aligns to 2:189/277 of 6b5kA
- binding magnesium ion: D108 (= D133)
- binding thymidine-5'-triphosphate: L6 (≠ P12), G8 (= G14), G9 (= G15), G11 (= G17), T12 (= T18), R13 (= R19), K23 (= K29), Q24 (≠ E30), Q80 (= Q105), P83 (= P108), G85 (= G110), L86 (= L111), G107 (≠ A132), D108 (= D133)
- binding thymidine-5'-diphosphate: M43 (≠ E49), Y112 (≠ V137), G113 (≠ S138), G115 (≠ C145), L116 (= L146), G117 (≠ R147), T118 (≠ Q148), S119 (≠ M149)
Sites not aligning to the query:
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
26% identity, 79% coverage: 8:237/292 of query aligns to 2:200/294 of 4ho9A
- binding galactose-uridine-5'-diphosphate: L6 (≠ P12), G8 (= G14), G9 (= G15), Q80 (= Q105), P83 (= P108), G85 (= G110), L86 (= L111), L106 (= L131), D108 (= D133), G144 (= G175), E159 (≠ G191), K160 (≠ L192), V170 (= V207), R192 (≠ G229)
- binding uridine 5'-triphosphate: L43 (≠ E49), G113 (≠ S138), H114 (≠ R143), G115 (= G144), T117 (≠ L146)
Sites not aligning to the query:
4ho6A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-glucose and utp
26% identity, 78% coverage: 8:236/292 of query aligns to 2:199/288 of 4ho6A
- binding uridine-5'-diphosphate-glucose: L6 (≠ P12), G8 (= G14), G9 (= G15), Q80 (= Q105), P83 (= P108), G85 (= G110), D108 (= D133), G144 (= G175), E159 (≠ G191), K160 (≠ L192), V170 (= V207), R192 (≠ G229)
- binding uridine 5'-triphosphate: L43 (≠ E49), Y112 (≠ V137), G113 (≠ S138), H114 (≠ R143), G115 (= G144), T117 (≠ L146)
Sites not aligning to the query:
4ho5A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with tdp-glucose
26% identity, 78% coverage: 8:236/292 of query aligns to 2:199/288 of 4ho5A
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L6 (≠ P12), G8 (= G14), G9 (= G15), Q24 (≠ E30), Q80 (= Q105), P83 (= P108), G85 (= G110), L86 (= L111), L106 (= L131), D108 (= D133), Y112 (≠ V137), G113 (≠ S138), H114 (≠ R143), G115 (= G144), F116 (≠ C145), T117 (≠ L146), F143 (≠ Y174), G144 (= G175), E159 (≠ G191), K160 (≠ L192), V170 (= V207)
Sites not aligning to the query:
4ho3A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine triphosphate
26% identity, 78% coverage: 8:236/292 of query aligns to 2:199/288 of 4ho3A
- binding thymidine-5'-triphosphate: L6 (≠ P12), G8 (= G14), G9 (= G15), G11 (= G17), T12 (= T18), R13 (= R19), Q24 (≠ E30), L43 (≠ E49), Q80 (= Q105), P83 (= P108), G85 (= G110), L86 (= L111), D108 (= D133), Y112 (≠ V137), G113 (≠ S138), H114 (≠ R143), G115 (= G144), F116 (≠ C145), T117 (≠ L146), E194 (= E231)
Sites not aligning to the query:
Query Sequence
>Ga0059261_3133 FitnessBrowser__Korea:Ga0059261_3133
MTIKPLRKAVFPVGGLGTRFLPATKALPKEMLPVVDRPLIQYAVDEALEAGIEQIIFVTG
RGKSAIEDHFDISYELETTMAARGKPLDVLDGTRLKPGAIAYVRQQEPMGLGHAVWCARD
IVGDEPFAVLLADDFMVSAQGQRGCLRQMVEAYNKVGGNLLCAQQVAEDQTDKYGVITPG
TRDGTLTEVKGLVEKPKAGTAPSNLAVIGRYILQPEVMRVLEGQEKGAGGEIQLTDAMAR
MIGGQPFHGVTFQGVRYDCGDKAGYAQANLALALSREDIGPAVREFAKGLLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory