Comparing Ga0059261_3185 FitnessBrowser__Korea:Ga0059261_3185 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
36% identity, 92% coverage: 33:437/439 of query aligns to 17:397/398 of 6slfA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 93% coverage: 26:435/439 of query aligns to 43:428/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
34% identity, 90% coverage: 42:438/439 of query aligns to 23:389/389 of 4ewtA
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
33% identity, 92% coverage: 29:432/439 of query aligns to 2:364/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 85% coverage: 43:417/439 of query aligns to 56:404/440 of O04373
>Ga0059261_3185 FitnessBrowser__Korea:Ga0059261_3185
MRMLATLLATSLFAAPALAGPDFAPAVDADYAAHLEKLFIDFHKNPELSFKETRTAAMMA
KELRAVGGITVTEGVGGTGVVGVMKNGDGPVVLVRADMDGLPLKEDSGLPYMSSVTQTDI
DGVVKPVMHACGHDVHITSMIGTARQLARMKDRWKGTVVFVVQPGEERIDGARRMLADGL
YTRFPKPNYAVAFHVTAGIPTGKIGLEPGISSSSSDSVDITIHGIGTHGAAPHLGKDPIV
MGAEIVMALQTLVSREIAPLKPGVVTVGSFHSGFKHNIISDKAELQLTVRSDDEDTRKKL
LDGIKRIAANVGRMNGLPEDKLPQVKVGFESTPVTLNDPELTKRVRGAITSAFGDNIIHY
EERAGMGAEDFAYFIQKDLGVPGAYFIVGGTPQAEIDAGKAGGKPVSGHHSPFFKIDPKP
SVTLGTTAMTVAVLDLLKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory