Comparing Ga0059261_3256 FitnessBrowser__Korea:Ga0059261_3256 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
41% identity, 95% coverage: 12:382/389 of query aligns to 31:399/403 of P48728
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
41% identity, 94% coverage: 18:382/389 of query aligns to 6:368/371 of 1wsvA
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
36% identity, 93% coverage: 18:377/389 of query aligns to 5:355/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
36% identity, 93% coverage: 18:377/389 of query aligns to 5:355/362 of 1wopA
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
36% identity, 93% coverage: 18:377/389 of query aligns to 5:355/362 of 1wooA
Sites not aligning to the query:
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
36% identity, 87% coverage: 18:355/389 of query aligns to 5:336/363 of 3a8iA
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 87% coverage: 42:378/389 of query aligns to 471:804/824 of 4pabB
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 87% coverage: 42:378/389 of query aligns to 508:841/857 of Q63342
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
25% identity, 87% coverage: 42:378/389 of query aligns to 515:848/866 of Q9UI17
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
26% identity, 96% coverage: 13:384/389 of query aligns to 426:824/827 of 1pj7A
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
26% identity, 96% coverage: 13:384/389 of query aligns to 427:825/828 of 1pj6A
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
26% identity, 96% coverage: 13:384/389 of query aligns to 429:827/830 of Q9AGP8
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
26% identity, 96% coverage: 13:384/389 of query aligns to 426:824/827 of 3gsiA
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
22% identity, 88% coverage: 38:378/389 of query aligns to 37:369/369 of 3tfjA
Sites not aligning to the query:
3tfiA Dmsp-dependent demethylase from p. Ubique - with substrate dmsp (see paper)
22% identity, 88% coverage: 38:378/389 of query aligns to 37:369/369 of 3tfiA
Sites not aligning to the query:
Q4FP21 Dimethylsulfonioproprionate demethylase DmdA; EC 2.1.1.269 from Pelagibacter ubique (strain HTCC1062) (see paper)
22% identity, 88% coverage: 38:378/389 of query aligns to 37:369/369 of Q4FP21
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
25% identity, 92% coverage: 22:377/389 of query aligns to 464:814/824 of Q8GAI3
Sites not aligning to the query:
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
24% identity, 67% coverage: 16:274/389 of query aligns to 576:848/965 of 2gagA
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
22% identity, 89% coverage: 9:356/389 of query aligns to 571:936/967 of Q46337
Sites not aligning to the query:
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
23% identity, 68% coverage: 9:274/389 of query aligns to 568:847/963 of 3ad7A
Sites not aligning to the query:
>Ga0059261_3256 FitnessBrowser__Korea:Ga0059261_3256
MSDATQEPEIVEELALLPLDAWHRAKGGRMVPFAGYEMPVQYEGIMAEHLWVRESAGLFD
VSHMGQLFLSGDGLDAALEALIPADVAGVKVNGQKYSLLLAQNGGILDDLMFTRWDADNG
AHPGAAGLYMVVNGACKWDDIAHLREHLPDEIEINHMDEHALLALQGPKAVDALSRLVPG
VEGLIFMRGGRFDWNGTSLWISRSGYTGEDGFEISVEADKAAALAGALTAQPEVKPIGLG
ARDSLRLEADLPLYGHDLDTETTPIMAALNFAVASKRRREEANFPGAERILLEREQGAIQ
RRVGLIVEGRQPVREGALVLDDEGNEVGRVTSGGFAPTVQKPIAMAYVPTAMAEVGTRVT
LSQRGKIHHGEVVPMPFVPHNYVREGGPK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory