SitesBLAST
Comparing Ga0059261_3284 FitnessBrowser__Korea:Ga0059261_3284 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
43% identity, 98% coverage: 5:389/391 of query aligns to 39:420/424 of P09110
- V387 (≠ T357) to A: in dbSNP:rs2229528
Sites not aligning to the query:
- 1:26 PTS2-type peroxisomal targeting signal
- 5 mutation Q->D,K,L: Does not affect localization to peroxisomes.
- 6 V→D: Abolished localization to peroxisomes.; V→K: Does not affect localization to peroxisomes.
- 7 mutation V->D,K: Abolished localization to peroxisomes.
- 8 mutation L->D,K: Does not affect localization to peroxisomes.
- 9 mutation G->D,R,L: Does not affect localization to peroxisomes.
- 10 H→E: In S3E mutant; Abolished localization to peroxisomes.
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
40% identity, 99% coverage: 3:391/391 of query aligns to 3:391/391 of 2vu1A
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
40% identity, 99% coverage: 3:391/391 of query aligns to 4:392/392 of 1ou6A
- active site: C89 (= C90), H348 (= H347), C378 (= C377), G380 (= G379)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (≠ M139), H156 (≠ P146), M157 (= M147), F235 (≠ V235), A243 (= A242), S247 (= S246), A318 (= A317), F319 (= F318), H348 (= H347)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
40% identity, 99% coverage: 3:391/391 of query aligns to 1:389/389 of 2vu2A
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (≠ P146), M154 (= M147), F232 (≠ V235), S244 (= S246), G245 (≠ Q247), F316 (= F318), H345 (= H347)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
40% identity, 99% coverage: 3:391/391 of query aligns to 1:389/389 of 1dm3A
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding acetyl coenzyme *a: C86 (= C90), L145 (≠ M139), H153 (≠ P146), M154 (= M147), R217 (= R220), S224 (≠ G227), M225 (≠ L228), A240 (= A242), S244 (= S246), M285 (= M287), A315 (= A317), F316 (= F318), H345 (= H347), C375 (= C377)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
40% identity, 99% coverage: 3:391/391 of query aligns to 1:389/389 of 1dlvA
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding coenzyme a: C86 (= C90), L145 (≠ M139), H153 (≠ P146), M154 (= M147), R217 (= R220), L228 (= L231), A240 (= A242), S244 (= S246), H345 (= H347)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
39% identity, 99% coverage: 4:391/391 of query aligns to 5:392/392 of P07097
- Q64 (≠ G65) mutation to A: Slightly lower activity.
- C89 (= C90) mutation to A: Loss of activity.
- C378 (= C377) mutation to G: Loss of activity.
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
40% identity, 99% coverage: 3:391/391 of query aligns to 1:389/389 of 2wkuA
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding D-mannose: S6 (= S8), A7 (≠ T9), R38 (= R41), K182 (≠ R175), D194 (= D187), V280 (≠ T282), D281 (≠ K283), T287 (≠ I289), P331 (≠ N333), S332 (≠ E334), V334 (≠ L336), V336 (= V338), F360 (≠ I362)
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
38% identity, 98% coverage: 1:385/391 of query aligns to 4:390/397 of P42765
- C92 (= C90) mutation to A: Decreased acyl-CoA hydrolase activity.; mutation to S: Decreased acyl-CoA hydrolase activity; when associated with A-382.
- R224 (= R220) binding
- T227 (= T223) binding
- S251 (= S246) binding
- C382 (= C377) mutation to S: Decreased acyl-CoA hydrolase activity; when associated with S-92.
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
38% identity, 98% coverage: 1:385/391 of query aligns to 7:389/395 of 4c2jD
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
40% identity, 99% coverage: 3:391/391 of query aligns to 2:390/390 of 1m1oA
- active site: A87 (≠ C90), H346 (= H347), C376 (= C377), G378 (= G379)
- binding acetoacetyl-coenzyme a: L86 (≠ Q89), A87 (≠ C90), L146 (≠ M139), H154 (≠ P146), M155 (= M147), R218 (= R220), S225 (≠ G227), M226 (≠ L228), A241 (= A242), G242 (= G243), S245 (= S246), A316 (= A317), F317 (= F318), H346 (= H347), I377 (≠ V378), G378 (= G379)
5bz4K Crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis (see paper)
39% identity, 99% coverage: 2:389/391 of query aligns to 1:396/400 of 5bz4K
- active site: C87 (= C90), H354 (= H347), C384 (= C377), G386 (= G379)
- binding coenzyme a: C87 (= C90), R146 (vs. gap), M160 (= M147), R220 (= R220), A246 (= A242), G247 (= G243), S250 (= S246), Q252 (≠ L248), M291 (= M287), A321 (= A317), F322 (= F318), H354 (= H347)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
37% identity, 99% coverage: 1:389/391 of query aligns to 1:390/392 of P45359
- V77 (= V79) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C90) modified: Disulfide link with 378, In inhibited form
- S96 (≠ A98) binding
- N153 (= N141) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AV 278:279) binding
- A286 (≠ D285) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C377) modified: Disulfide link with 88, In inhibited form
- A386 (= A385) binding
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
39% identity, 98% coverage: 1:385/391 of query aligns to 1:387/393 of P14611
- C88 (= C90) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ Y144) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ G218) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (= R220) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S246) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H347) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C377) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
2ib8D Crystallographic and kinetic studies of human mitochondrial acetoacetyl-coa thiolase (t2): the importance of potassium and chloride for its structure and function (see paper)
37% identity, 100% coverage: 1:391/391 of query aligns to 5:393/393 of 2ib8D
P24752 Acetyl-CoA acetyltransferase, mitochondrial; Acetoacetyl-CoA thiolase; T2; EC 2.3.1.9 from Homo sapiens (Human) (see 6 papers)
37% identity, 100% coverage: 1:391/391 of query aligns to 39:427/427 of P24752
- N93 (≠ A56) to S: in 3KTD; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074145
- N158 (≠ L122) to D: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs148639841
- G183 (vs. gap) to R: in 3KTD; no activity; dbSNP:rs120074141
- Y219 (≠ Q173) binding ; binding
- RVD 258:260 (≠ ETT 222:224) binding
- K263 (≠ G227) binding
- A280 (= A242) binding
- A281 (≠ G243) binding
- A283 (= A245) binding
- S284 (= S246) binding
- T297 (≠ E259) to M: in 3KTD; decreased protein abundance; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs886041122
- A301 (= A263) to P: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs1420321267
- I312 (≠ Y274) to T: in 3KTD; decreased protein stability; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074146
- A333 (≠ I295) to P: in 3KTD; loss of protein solubility; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs120074147
- A380 (≠ S342) to T: in 3KTD; decreased protein stability; dbSNP:rs120074140
- V381 (≠ I343) binding
Sites not aligning to the query:
- 5 A → P: in dbSNP:rs3741056
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
38% identity, 99% coverage: 2:389/391 of query aligns to 5:388/390 of 2d3tC
- active site: C94 (= C90), H346 (= H347), C376 (= C377), G378 (= G379)
- binding acetyl coenzyme *a: C94 (= C90), R214 (= R220), L222 (= L228), L225 (= L231), A238 (= A242), G239 (= G243), S242 (= S246), I244 (≠ L248), A313 (= A317), F314 (= F318), H346 (= H347), C376 (= C377)
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
37% identity, 99% coverage: 1:389/391 of query aligns to 1:390/392 of 4xl4A
- active site: C88 (= C90), H348 (= H347), S378 (≠ C377), G380 (= G379)
- binding coenzyme a: L148 (= L136), H156 (≠ Y144), R220 (= R220), L231 (= L231), A243 (= A242), S247 (= S246), F319 (= F318), H348 (= H347)
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
40% identity, 98% coverage: 1:385/391 of query aligns to 4:397/403 of 6pccA
- active site: C93 (= C90), A359 (≠ H347), C389 (= C377), G391 (= G379)
- binding coenzyme a: C93 (= C90), I148 (vs. gap), R229 (= R220), T232 (= T223), A252 (= A242), S256 (= S246), N325 (= N315), F328 (= F318)
- binding hexanal: N61 (≠ L58), T146 (vs. gap), I148 (vs. gap), G149 (vs. gap), R151 (vs. gap), L361 (≠ Y349)
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
40% identity, 98% coverage: 1:385/391 of query aligns to 4:397/403 of 6pcbA
- active site: C93 (= C90), A359 (≠ H347), C389 (= C377), G391 (= G379)
- binding coenzyme a: C93 (= C90), I148 (vs. gap), R229 (= R220), A252 (= A242), S256 (= S246), G257 (≠ Q247), N325 (= N315), F328 (= F318)
Query Sequence
>Ga0059261_3284 FitnessBrowser__Korea:Ga0059261_3284
MRSAVIVSTARTPIGRAYRGAFNALPAQTLAARSIEAAVQRAGIEGGEVQDVVFGAALQQ
GHQAGNIARQAALRAGLPVSVSGMSVDRQCASGLMAIATAAKQIIVDNMDIAIGGGVESI
SLVQTPQMRIAADPELLAMHNDVYMPMLQTAEVVAARYNISREVQDEYSLQSQQRTAAAQ
AAGKFDDEIVPVTATMNIVNKETKEVTQKEVTLTKDEGNRPETTLEGLQALQPVVPNGVI
TAGNASQLSDGSSSSVLMEEKLAEKRGLTPLGRYVGMAVAGTKPDEMGIGPVFAIPALLE
RFNLKMDDIGLWELNEAFAVQVLYCRDKLGIPNELLNVNGGSISIGHPYGMTGARCTGHA
LIEGKRRGAKYVVVTMCVGGGMGAAGLFEVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory