SitesBLAST
Comparing Ga0059261_3317 FitnessBrowser__Korea:Ga0059261_3317 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
28% identity, 72% coverage: 133:484/486 of query aligns to 40:397/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: G40 (= G133), L41 (≠ A134)
- binding 2-oxoglutaric acid: D213 (= D303), P214 (≠ Y304), Y215 (≠ D305), G216 (≠ H306), E217 (= E307), G241 (= G330), T242 (≠ S331), I246 (≠ L335)
- binding (2E)-pent-2-enedioic acid: G40 (= G133), Y130 (= Y225), N184 (≠ F274), R376 (= R463)
- binding glutamic acid: L131 (≠ E226), V360 (≠ A447), A364 (≠ S451), R369 (≠ D456)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G199), S105 (= S200), Q106 (= Q201), Y130 (= Y225), N184 (≠ F274), D212 (= D302), P214 (≠ Y304), Y215 (≠ D305), T242 (≠ S331), S244 (= S333), K245 (= K334), R252 (= R341)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
28% identity, 72% coverage: 133:484/486 of query aligns to 40:397/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ E226), Q135 (≠ A230), A364 (≠ S451), R369 (≠ D456)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: G40 (= G133), Y130 (= Y225), L131 (≠ E226), A132 (≠ P227), N184 (≠ F274), R376 (= R463)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G199), S105 (= S200), Q106 (= Q201), Y130 (= Y225), V179 (≠ T269), N184 (≠ F274), D212 (= D302), P214 (≠ Y304), Y215 (≠ D305), T242 (≠ S331), S244 (= S333), K245 (= K334), R252 (= R341)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
28% identity, 72% coverage: 133:484/486 of query aligns to 40:397/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y164), Y130 (= Y225), L275 (≠ G364)
- binding pyridoxal-5'-phosphate: G104 (= G199), S105 (= S200), Q106 (= Q201), Y130 (= Y225), V179 (≠ T269), N184 (≠ F274), D212 (= D302), P214 (≠ Y304), Y215 (≠ D305), T242 (≠ S331), S244 (= S333), K245 (= K334), R252 (= R341)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
28% identity, 72% coverage: 133:484/486 of query aligns to 40:397/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G199), S105 (= S200), Q106 (= Q201), Y130 (= Y225), V179 (≠ T269), N184 (≠ F274), D212 (= D302), P214 (≠ Y304), Y215 (≠ D305), T242 (≠ S331), S244 (= S333), K245 (= K334), R252 (= R341)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
27% identity, 73% coverage: 128:484/486 of query aligns to 32:395/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G199), S103 (= S200), Q104 (= Q201), Y128 (= Y225), V177 (≠ T269), N182 (≠ F274), D210 (= D302), P212 (≠ Y304), Y213 (≠ D305), T240 (≠ S331), S242 (= S333), K243 (= K334), R250 (= R341)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
26% identity, 96% coverage: 19:486/486 of query aligns to 8:457/458 of 7zlaB
- binding : P9 (= P20), L10 (≠ I21), Y11 (= Y22), S35 (= S46), K36 (≠ S47), R37 (= R48), K38 (≠ E49), Q47 (≠ R58), Q47 (≠ R58), N48 (≠ K59), T49 (= T60), R68 (≠ T79)
Sites not aligning to the query:
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
27% identity, 73% coverage: 128:481/486 of query aligns to 37:397/405 of 2zc0A
- active site: Y132 (= Y225), D214 (= D302), A216 (≠ Y304), S246 (= S333)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G199), G107 (≠ S200), T108 (≠ Q201), Y132 (= Y225), N186 (≠ F274), D214 (= D302), A216 (≠ Y304), Y217 (≠ D305), T244 (≠ S331), S246 (= S333), K247 (= K334), R254 (= R341)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
31% identity, 72% coverage: 120:470/486 of query aligns to 26:375/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ E132), G40 (= G133), G99 (= G199), S100 (= S200), Q101 (= Q201), Y125 (= Y225), N174 (≠ F274), D202 (= D302), Y205 (≠ D305), S235 (= S331), S237 (= S333), K238 (= K334), R245 (= R341), R368 (= R463)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
31% identity, 72% coverage: 120:470/486 of query aligns to 26:375/397 of Q72LL6
- G40 (= G133) binding
- Y70 (= Y164) binding
- N174 (≠ F274) binding ; binding
- R245 (= R341) binding
- R368 (= R463) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
31% identity, 72% coverage: 120:470/486 of query aligns to 22:371/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ E132), G36 (= G133), G95 (= G199), S96 (= S200), Q97 (= Q201), Y121 (= Y225), N170 (≠ F274), D198 (= D302), Y201 (≠ D305), S231 (= S331), S233 (= S333), K234 (= K334), R241 (= R341), R364 (= R463)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
31% identity, 72% coverage: 120:470/486 of query aligns to 22:371/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G199), S96 (= S200), Q97 (= Q201), Y121 (= Y225), N170 (≠ F274), D198 (= D302), A200 (≠ Y304), Y201 (≠ D305), S231 (= S331), S233 (= S333), K234 (= K334), R241 (= R341)
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
25% identity, 96% coverage: 20:486/486 of query aligns to 6:434/435 of 7zn5B
- binding : P6 (= P20), S32 (= S46), R34 (= R48), K35 (≠ E49), S43 (≠ N57), Q44 (≠ R58), N45 (≠ K59), E48 (≠ V62), R65 (≠ T79), K66 (≠ R80), R341 (≠ A395)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
30% identity, 65% coverage: 155:470/486 of query aligns to 53:367/389 of 2z1yA
- binding leucine: Y117 (= Y225), R360 (= R463)
- binding pyridoxal-5'-phosphate: G91 (= G199), S92 (= S200), Q93 (= Q201), Y117 (= Y225), N166 (≠ F274), D194 (= D302), Y197 (≠ D305), S227 (= S331), S229 (= S333), K230 (= K334), R237 (= R341)
Sites not aligning to the query:
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
25% identity, 73% coverage: 133:485/486 of query aligns to 46:410/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G199), S113 (= S200), Q114 (= Q201), Y138 (= Y225), N194 (≠ F274), D222 (= D302), P224 (≠ Y304), Y225 (≠ D305), T252 (≠ S331), S254 (= S333), K255 (= K334), R262 (= R341)
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
29% identity, 72% coverage: 134:485/486 of query aligns to 9:361/365 of 5x03B
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
25% identity, 74% coverage: 123:483/486 of query aligns to 18:408/414 of 2vgzA
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
29% identity, 72% coverage: 134:485/486 of query aligns to 9:356/358 of 6uxzB
- binding (4S)-4-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-5-phenoxypentanoic acid: G73 (= G199), T74 (≠ S200), Y98 (= Y225), R100 (≠ P227), F143 (= F274), D172 (= D302), Y174 (= Y304), T202 (≠ S331), S204 (= S333), K205 (= K334), P209 (= P338), R212 (= R341), R323 (= R450)
Sites not aligning to the query:
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
25% identity, 74% coverage: 123:483/486 of query aligns to 16:406/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: G26 (= G133), L27 (≠ A134), Y61 (≠ E175), L280 (≠ G364)
- binding pyridoxal-5'-phosphate: S104 (= S200), Q105 (= Q201), Y129 (= Y225), D217 (= D302), P219 (vs. gap), S247 (= S331), S249 (= S333), R257 (= R341)
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
29% identity, 72% coverage: 134:485/486 of query aligns to 10:357/360 of 5t4kA
Sites not aligning to the query:
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
29% identity, 72% coverage: 134:485/486 of query aligns to 10:357/360 of 5t4jB
- binding gamma-amino-butanoic acid: Y99 (= Y225), Y175 (= Y304), R324 (= R450)
- binding pyridoxal-5'-phosphate: T75 (≠ S200), Y99 (= Y225), F144 (= F274), D173 (= D302), Y175 (= Y304), T203 (≠ S331), S205 (= S333), R213 (= R341), S215 (≠ G343)
Sites not aligning to the query:
Query Sequence
>Ga0059261_3317 FitnessBrowser__Korea:Ga0059261_3317
MLRPWQVSLGERIDPARDVPIYMQIIQALIRDIERGRLTSGTYLPSSRELAQVLGVNRKT
VVLAYEDLIAQGWLDSAGTRGTMVSASLPEPAKKQRAEAEATMSNVPVDYRFAAPPQRPL
ALPSGPGLKLDEGAPDGRLFPADLLARAYRSAAHRASRENRFQYGNPRGTPALRESIATM
LKSQRGLPVTAENICITRGSQNGIFLAAQVLVRPGDTVIVEALTYEPAVAAFRALGANIV
AVGLDEDGIDIDAVEHACRRNAVRAVFVTPHHQFPTTVSLRPERRLRLLELSHQFGFAII
EDDYDHEFHFESQPLLPMAGYGPGHVIYVGSMSKLLLPALRIGYVAAPPPVIDAIAHMVS
LTDGMGNALTEDAAAELIENGELRRHARKVRQVYAKRRENFAAEIDRTLGDIVDYKMPDG
GLAFWLRFHTDLDAMEARAAAMGLRFAASRSFMTRDDAPRGLRIGFASLNEHEAKTAVAA
LREAAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory