Comparing Ga0059261_3322 Ga0059261_3322 Arabinose efflux permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 51% coverage: 91:319/445 of query aligns to 92:315/444 of Q8NLB7
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
26% identity, 42% coverage: 66:252/445 of query aligns to 37:213/437 of 6rw3A
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
31% identity, 20% coverage: 84:171/445 of query aligns to 139:215/447 of 8sc6A
Sites not aligning to the query:
>Ga0059261_3322 Ga0059261_3322 Arabinose efflux permease
MARIPGMIGVPADGDAPLDTRPAHAVPLDRRTRARAAVAGSVGNLIEWYDFYAYAYTALY
FASAFFPAGDRTAQLLNVAAIYAAGFLIRPLGGWFFGRYADRHGRRAAMIASVVLMGAGS
LLVGVLPTYATIGAAAPALLLVARLMQGFSTGGQYGAAATYLSEIAEPGKRGFYASFQFV
TLIGGQLFALLVVFALQSTMSETAIREWGWRLPFLLGAVLAGVFILFRDVMHETAEPASK
GEDAGSLKALFQHPRAMFVVMALSAAGAVTLYTFTTYMQKYLVNTAGMDVASASRTMLIV
TFAFLLLQPVLGTLSDRIGRRTNLLIFSGGMTLFAVPLLGAIGQAQTMWSAGLLVFAALA
IMSFYTSVSGLFKAELFPARVRALGVGLGHAIASAIFGGTAEWAALMLKQMGHEGLFAWY
VSAVCAVAFVVAWQMREPRAHGHLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory