SitesBLAST
Comparing Ga0059261_3340 FitnessBrowser__Korea:Ga0059261_3340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8hw0A The structure of akr6d1
37% identity, 93% coverage: 1:326/351 of query aligns to 1:329/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), W21 (vs. gap), Q27 (≠ K34), D49 (= D56), Y54 (= Y61), R123 (= R128), S152 (= S157), Q178 (= Q183), W207 (= W211), S208 (= S212), P209 (= P213), L210 (= L214), S212 (≠ G216), K218 (= K222), S227 (≠ T224), R228 (= R225), I285 (≠ L284), G287 (= G286), S289 (≠ T288), Q293 (= Q292), D296 (= D295), N297 (= N296)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
36% identity, 90% coverage: 1:315/351 of query aligns to 1:315/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), D49 (= D56), Y54 (= Y61), S151 (= S157), Y204 (≠ W211), F205 (≠ S212), L207 (= L214), Q209 (≠ G216), G210 (= G217), T213 (= T220), K215 (= K222), R227 (≠ H238), V284 (≠ L284), G286 (= G286), Q292 (= Q292), N296 (= N296)
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
36% identity, 90% coverage: 1:315/351 of query aligns to 1:291/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G19), L21 (≠ M21), Y50 (= Y61), H117 (= H127), S147 (= S157), Y200 (≠ W211), F201 (≠ S212), L203 (= L214), Q205 (≠ G216), T209 (= T220), Q268 (= Q292), N272 (= N296)
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 89% coverage: 2:314/351 of query aligns to 8:340/351 of Q9P7U2
- S113 (vs. gap) modified: Phosphoserine
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
35% identity, 89% coverage: 2:315/351 of query aligns to 38:354/367 of Q13303
- T56 (= T20) binding
- W57 (≠ M21) binding
- Q63 (≠ G28) binding
- D85 (= D56) binding
- Y90 (= Y61) mutation to F: No effect on its activity in promoting KCNA4 channel closure.
- S112 (≠ E80) modified: Phosphoserine
- S188 (= S157) binding
- R189 (≠ N158) binding
- Q214 (= Q183) binding
- W243 (= W211) binding
- S244 (= S212) binding
- P245 (= P213) binding
- L246 (= L214) binding
- A247 (≠ G215) binding
- C248 (≠ G216) binding
- K254 (= K222) binding
- R264 (= R225) binding
- S325 (≠ T288) binding
- Q329 (= Q292) binding
- E332 (≠ D295) binding
- N333 (= N296) binding
Sites not aligning to the query:
- 31 modified: Phosphoserine
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
35% identity, 89% coverage: 2:315/351 of query aligns to 5:321/328 of 7wf3C
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G19), R156 (≠ N158), W210 (= W211), S211 (= S212), P212 (= P213), L213 (= L214), C215 (≠ G216), K221 (= K222), R231 (= R225), Q296 (= Q292), E299 (≠ D295), N300 (= N296)
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
35% identity, 89% coverage: 2:315/351 of query aligns to 38:354/367 of P62483
- T56 (= T20) binding
- W57 (≠ M21) binding
- Q63 (≠ G28) binding
- D85 (= D56) binding
- Y90 (= Y61) mutation to F: Abolishes enzyme activity, but has no effect on NADPH binding.
- S112 (≠ E80) modified: Phosphoserine
- N158 (≠ H127) binding
- S188 (= S157) binding
- R189 (≠ N158) binding
- Q214 (= Q183) binding
- W243 (= W211) binding
- S244 (= S212) binding
- P245 (= P213) binding
- L246 (= L214) binding
- A247 (≠ G215) binding
- C248 (≠ G216) binding
- K254 (= K222) binding
- Y262 (= Y223) binding
- R264 (= R225) binding
- G323 (= G286) binding
- S325 (≠ T288) binding
- Q329 (= Q292) binding
- E332 (≠ D295) binding
- N333 (= N296) binding
Sites not aligning to the query:
- 9 modified: Phosphoserine; S→A: Impairs interaction with MAPRE1 and association with microtubules.
- 20 modified: Phosphoserine; S→A: No effect on interaction with MAPRE1 and association with microtubules.
- 31 S→A: Impairs interaction with MAPRE1 and association with microtubules.
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
35% identity, 89% coverage: 2:315/351 of query aligns to 38:354/367 of P62482
- Y90 (= Y61) mutation to F: No detectable phenotype.
- S112 (≠ E80) modified: Phosphoserine
Sites not aligning to the query:
- 20 modified: Phosphoserine
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
35% identity, 89% coverage: 2:315/351 of query aligns to 3:319/326 of 1exbA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G19), W22 (≠ M21), Q28 (≠ G28), D50 (= D56), Y55 (= Y61), S153 (= S157), R154 (≠ N158), Q179 (= Q183), W208 (= W211), S209 (= S212), P210 (= P213), L211 (= L214), C213 (≠ G216), G214 (= G217), S217 (≠ T220), K219 (= K222), S228 (≠ T224), R229 (= R225), L286 (= L284), G288 (= G286), S290 (≠ T288), Q294 (= Q292), E297 (≠ D295), N298 (= N296)
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
35% identity, 89% coverage: 2:315/351 of query aligns to 4:320/327 of 3eauA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G19), W23 (≠ M21), Q29 (≠ G28), D51 (= D56), Y56 (= Y61), K84 (= K86), S154 (= S157), Q180 (= Q183), W209 (= W211), S210 (= S212), P211 (= P213), L212 (= L214), A213 (≠ G215), C214 (≠ G216), G215 (= G217), K220 (= K222), R230 (= R225), L287 (= L284), L288 (= L285), G289 (= G286), S291 (≠ T288), Q295 (= Q292), E298 (≠ D295), N299 (= N296)
- binding 17,21-dihydroxypregna-1,4-diene-3,11,20-trione: W23 (≠ M21), V55 (= V60), Y56 (= Y61), W87 (= W89), N124 (≠ H127), R155 (≠ N158), I174 (≠ A177), I177 (≠ T180), I202 (≠ Y204)
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
35% identity, 86% coverage: 1:302/351 of query aligns to 71:373/401 of P63144
- K152 (= K86) mutation to M: Loss of enzyme activity.
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 90% coverage: 1:317/351 of query aligns to 1:310/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
32% identity, 89% coverage: 4:317/351 of query aligns to 3:309/311 of 1pz0A
- active site: D52 (= D56), Y57 (= Y61), N91 (≠ P94), H124 (= H127)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H127), Q174 (= Q183), Y202 (≠ W211), F203 (≠ S212), P204 (= P213), L205 (= L214), S207 (≠ G216), G208 (= G217), A211 (≠ T220), K213 (= K222)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
32% identity, 89% coverage: 5:316/351 of query aligns to 5:306/337 of Q3L181
- D52 (= D56) mutation to A: 99% loss of activity.
- Y57 (= Y61) mutation to A: 99% loss of activity.
- K84 (= K86) mutation to A: Total loss of activity.
- H126 (= H127) mutation to A: 98% loss of activity.
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
35% identity, 86% coverage: 1:302/351 of query aligns to 89:391/419 of Q14722
- Y307 (= Y223) mutation to F: Reduces affinity for NADPH.
- R316 (≠ D232) mutation to E: Nearly abolishes NADPH binding.
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
35% identity, 89% coverage: 1:314/351 of query aligns to 11:319/335 of 4aubB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G19), W31 (≠ F23), D59 (= D56), Y64 (= Y61), H136 (= H127), Q191 (= Q183), F220 (≠ W211), T221 (≠ S212), P222 (= P213), L223 (= L214), Q225 (≠ G216), G226 (= G217), K231 (= K222), R241 (= R234), R244 (≠ S237), L288 (= L284), G290 (= G286), S292 (≠ T288), Q296 (= Q292), E299 (≠ D295), N300 (= N296)
Sites not aligning to the query:
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
35% identity, 91% coverage: 1:318/351 of query aligns to 12:313/313 of 6hg6A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G30 (= G19), W32 (≠ T22), D60 (= D56), Y65 (= Y61), H137 (= H127), Q192 (= Q183), F221 (≠ W211), S222 (= S212), P223 (= P213), L224 (= L214), L278 (= L284), I279 (≠ L285), G280 (= G286), Q286 (= Q292), E289 (≠ D295), N290 (= N296)
3n6qD Crystal structure of yghz from e. Coli (see paper)
34% identity, 89% coverage: 1:314/351 of query aligns to 12:306/315 of 3n6qD
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
32% identity, 89% coverage: 5:316/351 of query aligns to 5:274/287 of 3v0sA
- active site: D45 (= D56), Y50 (= Y61), G87 (= G99), H119 (= H127)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (= S212), P199 (= P213), I200 (≠ L214), G201 (= G215), L204 (≠ F218), P246 (≠ L285), G247 (= G286), T248 (≠ A287), T249 (= T288), N253 (≠ Q292), N256 (≠ D295), N257 (= N296)
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
34% identity, 90% coverage: 1:315/351 of query aligns to 13:312/315 of 5t79A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G31 (= G19), W33 (≠ T22), Y66 (= Y61), H138 (= H127), N169 (= N158), Q193 (= Q183), F221 (≠ W211), S222 (= S212), L224 (= L214), G226 (= G216), T230 (= T220), R232 (≠ K222), S263 (≠ A267), L280 (= L284), G282 (= G286), S284 (≠ T288), Q288 (= Q292)
Query Sequence
>Ga0059261_3340 FitnessBrowser__Korea:Ga0059261_3340
MLYSRLGDSGLIVSRLSLGTMTFTRGGGLKAIAKTDLKDAAALVDHALAAGINFIDTADV
YSDFESEEMLGKIVAGRRDELVIATKAGWRTGQPLNRSGLSAAHLHWSIDHSLKRLGTDH
VDVYIAHRDDRNTPLEETLQALDAIVRAGKARYLGVSNWPAWKVAAAIELQRANGWAPFT
HAQMLYSLMHRDIEQEFLPMARRYGLGITPWSPLGGGFLTGKYTRDNAGGADDRLASHDD
IPLDREMGYKLIDTMRGIADGHGVSIAQIALAWLLSKDQVSSILLGATKLHQLDDNLAAV
NVKLSDDEIAAMEEISAQRRAYPGFFIDRIDQPIAHALGARPGAPYSPAKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory