SitesBLAST
Comparing Ga0059261_3350 FitnessBrowser__Korea:Ga0059261_3350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
38% identity, 94% coverage: 19:426/436 of query aligns to 4:420/425 of O59010
- S65 (≠ T78) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S283) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 283:285) binding
- M311 (= M319) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A322) binding
- V355 (= V363) binding
- D394 (= D400) binding
- M395 (= M401) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R403) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N407) binding
- D405 (= D411) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
39% identity, 90% coverage: 31:422/436 of query aligns to 3:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
38% identity, 93% coverage: 19:425/436 of query aligns to 4:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ F19), Y7 (≠ A22), F46 (≠ I59), F46 (≠ I59), P75 (= P89), L91 (≠ F105), F95 (≠ L109), L130 (≠ T143), I133 (≠ M146), I159 (= I172), Y167 (vs. gap), K196 (= K201), G200 (≠ F205), I207 (≠ F212), F210 (= F215), L250 (≠ V257), I262 (≠ F269), M269 (≠ I276), T334 (= T342), V335 (≠ W343), G336 (≠ A344), T340 (≠ V348), L343 (≠ A351), M399 (≠ V405)
- binding aspartic acid: S277 (= S284), S278 (= S285), T314 (≠ A322), G354 (≠ P362), A358 (≠ G366), G359 (≠ S367), D394 (= D400), R397 (= R403), T398 (= T404)
- binding sodium ion: Y89 (= Y103), T92 (= T106), S93 (≠ T107), G306 (= G314), T308 (= T316), N310 (≠ G318), N310 (≠ G318), M311 (= M319), D312 (= D320), S349 (≠ A357), I350 (≠ M358), T352 (≠ V360), N401 (= N407), V402 (= V408), D405 (= D411)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
38% identity, 93% coverage: 19:422/436 of query aligns to 1:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ A22), G66 (= G82), V83 (≠ L100), I157 (≠ L173), Y164 (vs. gap), K193 (= K201), T305 (= T316), I306 (= I317), I347 (≠ M358)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I35), M199 (= M207), S275 (= S285), T311 (≠ A322), G356 (≠ S367), L384 (= L393), D391 (= D400), R394 (= R403)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
38% identity, 90% coverage: 31:423/436 of query aligns to 4:409/409 of 6bavA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
40% identity, 91% coverage: 31:426/436 of query aligns to 13:418/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
40% identity, 91% coverage: 31:426/436 of query aligns to 12:417/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K201), G195 (≠ F205), R282 (= R294)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S283), S272 (= S284), S273 (= S285), M307 (= M319), T310 (≠ A322), G353 (≠ S365), A354 (≠ G366), R394 (= R403), T395 (= T404)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
40% identity, 91% coverage: 31:426/436 of query aligns to 15:420/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
40% identity, 91% coverage: 31:426/436 of query aligns to 15:420/427 of 5e9sA
- binding aspartic acid: R274 (≠ S283), S275 (= S284), S276 (= S285), T313 (≠ A322), G353 (≠ P362), V354 (= V363), A357 (≠ G366), G358 (≠ S367), D394 (= D400), R397 (= R403), T398 (= T404)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K201), G198 (≠ F205), Y202 (≠ T209)
- binding sodium ion: Y87 (= Y103), T90 (= T106), S91 (≠ T107), S276 (= S285), G305 (= G314), A306 (= A315), T307 (= T316), N309 (≠ G318), N309 (≠ G318), M310 (= M319), D311 (= D320), S348 (≠ A357), I349 (≠ M358), G350 (= G359), T351 (≠ V360), N401 (= N407), V402 (= V408), D405 (= D411)
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
38% identity, 90% coverage: 31:422/436 of query aligns to 4:408/408 of 6bauA
- binding cysteine: S270 (= S285), M303 (= M319), T306 (≠ A322), A345 (= A361), G346 (≠ P362), V347 (= V363), G351 (≠ S367), D386 (= D400), C389 (≠ R403), T390 (= T404), N393 (= N407)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
39% identity, 91% coverage: 31:426/436 of query aligns to 8:409/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S283), S265 (= S285), M299 (= M319), T302 (≠ A322), T340 (≠ V360), G342 (≠ P362), V343 (= V363), G347 (≠ S367), D383 (= D400), R386 (= R403), T387 (= T404), N390 (= N407)
- binding decyl-beta-d-maltopyranoside: H23 (≠ V47), V212 (≠ F230), A216 (≠ L234)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
38% identity, 89% coverage: 33:422/436 of query aligns to 6:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
32% identity, 84% coverage: 57:424/436 of query aligns to 54:407/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L92), G89 (= G93), G92 (= G96), A95 (≠ T99), V96 (≠ L100), Y99 (= Y103), M163 (≠ I172), F167 (≠ A176), F293 (≠ T309), V297 (≠ L313)
- binding aspartic acid: S268 (= S284), S269 (= S285), T306 (≠ A322), G346 (≠ P362), I347 (≠ V363), A350 (≠ G366), G351 (≠ S367), D380 (= D400), R383 (= R403), T384 (= T404)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
30% identity, 86% coverage: 35:411/436 of query aligns to 30:449/503 of Q10901
- N177 (= N154) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ D161) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
31% identity, 84% coverage: 57:424/436 of query aligns to 46:393/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V83), S80 (≠ L92), G81 (= G93), G84 (= G96), Y91 (= Y103), M156 (≠ I172), F160 (≠ A176), F286 (≠ T309), V290 (≠ L313)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V75), I148 (≠ T164), S262 (= S285), S263 (= S286), A292 (= A315), T293 (= T316), M296 (= M319), T299 (≠ A322), G329 (= G359), A336 (≠ G366), G337 (≠ S367), D366 (= D400), R369 (= R403), N373 (= N407)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
32% identity, 85% coverage: 57:428/436 of query aligns to 40:415/416 of 8cuaA
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
31% identity, 85% coverage: 57:428/436 of query aligns to 44:430/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S285), D398 (= D400), R401 (= R403), T402 (= T404), N405 (= N407)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P364), D398 (= D400), R401 (= R403), T402 (= T404)
- binding cholesterol hemisuccinate: I258 (≠ M260), L419 (≠ V418)
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
31% identity, 85% coverage: 57:428/436 of query aligns to 44:430/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S284), S287 (= S285), T324 (≠ A322), A358 (≠ V356), G361 (= G359), V365 (= V363), A368 (≠ G366), T372 (≠ V370), D398 (= D400), R401 (= R403), T402 (= T404), N405 (= N407)
- binding cholesterol hemisuccinate: K80 (≠ S94), R84 (≠ K98)
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
32% identity, 81% coverage: 57:411/436 of query aligns to 37:391/406 of 8ctcA
- binding glutamic acid: S268 (= S284), S269 (= S285), M303 (= M319), T306 (≠ A322), G346 (≠ P362), A350 (≠ G366), D380 (= D400), R383 (= R403)
- binding sodium ion: Y82 (= Y103), T85 (= T106), T86 (= T107), S269 (= S285), G298 (= G314), A299 (= A315), T300 (= T316), N302 (≠ G318), N302 (≠ G318), M303 (= M319), D304 (= D320), S341 (≠ A357), I342 (≠ M358), G343 (= G359), A344 (≠ V360), N387 (= N407), D391 (= D411)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
31% identity, 85% coverage: 57:428/436 of query aligns to 40:433/433 of 8cv2A
- binding sodium ion: Y85 (= Y103), T88 (= T106), T89 (= T107), G319 (= G314), A320 (= A315), N323 (≠ G318), N323 (≠ G318), M324 (= M319), D325 (= D320), N408 (= N407), D412 (= D411)
Query Sequence
>Ga0059261_3350 FitnessBrowser__Korea:Ga0059261_3350
MTETTPPEPIAPGAQLHPFRRALGWWFGVALWRRILGALVLGAIAGVAWGPGATSIAWIG
ELFVRLIRMLVVPLVFLTIAAGVAALADPKRLGSIGVKTLAMYVFTTTLAVTTGLIVATL
IGPGIGASFADAVPRAMGTPPDTARMFMEIIPDNPVGAMADGKTLSVIFFAILVGAGVIA
AGKGAEPVRAFLNGASDVMLKIVGFVMETAPFGVFALIAVVMGTSGPASFLAILKLAICV
VAGSAVVTLLIHGLIVVRLMAWLSPLPFFRGIADAIMVGFSTSSSSATLPVAIRVAQNNL
GISKPVASTVLPLGATIGMDGAAMYVAMLTLFSAQAFGLDLTWADYLVIAATTTIVAMGV
APVPSGSLFVLAAVLHAIGITPEQTALVVGFVLPFDRILDMTRTVPNVTSDLAIATAVAR
WEGEMDVTVYNSANDV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory