Comparing Ga0059261_3351 FitnessBrowser__Korea:Ga0059261_3351 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
25% identity, 72% coverage: 113:403/405 of query aligns to 55:346/363 of 7cyxA
Sites not aligning to the query:
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 64% coverage: 110:367/405 of query aligns to 61:315/370 of 4yshA
Sites not aligning to the query:
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
27% identity, 64% coverage: 110:367/405 of query aligns to 62:317/377 of Q5L2C2
Sites not aligning to the query:
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
27% identity, 64% coverage: 110:367/405 of query aligns to 61:315/368 of 4yshB
Sites not aligning to the query:
6j39A Crystal structure of cmis2 with inhibitor (see paper)
28% identity, 55% coverage: 180:401/405 of query aligns to 130:351/368 of 6j39A
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
28% identity, 55% coverage: 180:401/405 of query aligns to 130:351/368 of 6j38A
Sites not aligning to the query:
>Ga0059261_3351 FitnessBrowser__Korea:Ga0059261_3351
MSRREEIIVLGAGVVGMATALTLAGRGHRVTVVDGAGGPGLGTSFANGAQLSYAYTDALA
SPSVLRQIPHILLGLDPALRFQPHLDPDFLRWSIAFLRNCGAGSFRRNTLAGLALAARSR
LALDQLTERHALEYGQSVPGKIHIYRTAASFAAAEAMVALKRANGITQTLLDPDAAVALE
PMLAPVRDEIAGALHTPGEAVGDPHRFCSGAHDALIRAGGSSMFDLPVERIETQGSQPAI
VTRCGTRVPADRIVLAAGPGAPRLARSLGVYLPVQPMKGYSITAPTGAAAPRASITDVAN
RVVFARLGNRMRIAGLAEVGRRDTRVEPDRLRALTDSARAALPQAADYDNIESSWAGLRP
MTPDSLPITRTIAPGVIANTGHGGLGWTYAAGSAERVAQIIEGTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory