SitesBLAST
Comparing Ga0059261_3382 FitnessBrowser__Korea:Ga0059261_3382 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
64% identity, 100% coverage: 2:245/245 of query aligns to 3:246/246 of 5u2wA
- active site: G17 (= G16), S141 (= S140), M152 (≠ F151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S15 (= S14), R16 (= R15), G17 (= G16), I18 (= I17), Y37 (= Y36), E38 (≠ A37), K39 (≠ S38), S40 (= S39), A63 (= A62), D64 (= D63), S65 (≠ N64), N91 (= N90), A92 (= A91), G93 (= G92), T139 (≠ I138), Y155 (= Y154), K159 (= K158), P185 (= P184), G186 (= G185), T188 (= T187), T190 (= T189), M192 (= M191), N193 (= N192)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
54% identity, 98% coverage: 3:242/245 of query aligns to 3:244/247 of 6j7uA
- active site: G16 (= G16), S142 (= S140), Y156 (= Y154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), I17 (= I17), Y36 (= Y36), V37 (vs. gap), S38 (vs. gap), S41 (= S39), D65 (= D63), S66 (≠ N64), N92 (= N90), A93 (= A91), G94 (= G92), I115 (≠ V113), G141 (= G139), S142 (= S140), Y156 (= Y154), K160 (= K158), P186 (= P184), T191 (= T189), M193 (= M191), N194 (= N192)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
51% identity, 99% coverage: 3:245/245 of query aligns to 3:245/245 of 5wuwA
- active site: G16 (= G16), S140 (= S140), Y154 (= Y154), L161 (≠ V161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), R15 (= R15), I17 (= I17), Y36 (= Y36), A37 (= A37), A38 (≠ S38), D63 (= D63), S64 (≠ N64), N90 (= N90), A91 (= A91), G92 (= G92), Y154 (= Y154), K158 (= K158), G185 (= G185), P186 (≠ S186), V187 (≠ T187)
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
45% identity, 97% coverage: 1:237/245 of query aligns to 2:242/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S15 (= S14), R16 (= R15), G17 (= G16), I18 (= I17), H36 (≠ T35), Y37 (= Y36), G38 (≠ A37), H39 (≠ S38), L65 (vs. gap), N97 (= N90), G99 (= G92), S147 (≠ N141), Y160 (= Y154), K164 (= K158), G191 (= G185), T193 (= T187), T195 (= T189)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
41% identity, 99% coverage: 2:243/245 of query aligns to 6:260/261 of 4fj0D
- active site: G20 (= G16), S144 (= S140), N145 (= N141), H155 (≠ F151), Y158 (= Y154), K162 (= K158), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S140), N145 (= N141), G190 (≠ S186), F196 (≠ N192), S200 (vs. gap), Y203 (vs. gap), A219 (= A207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G12), R19 (= R15), G20 (= G16), I21 (= I17), A41 (= A37), N42 (≠ S38), S43 (= S39), I68 (≠ N64), N94 (= N90), S95 (≠ A91), G96 (= G92), L117 (≠ V113), T142 (≠ I138), Y158 (= Y154), K162 (= K158), P188 (= P184), G189 (= G185), G190 (≠ S186), T191 (= T187), T193 (= T189), M195 (= M191)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
41% identity, 99% coverage: 2:243/245 of query aligns to 5:259/260 of 4fj2B
- active site: G19 (= G16), S143 (= S140), N144 (= N141), H154 (≠ F151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), G19 (= G16), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (= S39), I67 (≠ N64), N93 (= N90), S94 (≠ A91), G95 (= G92), L116 (≠ V113), T141 (≠ I138), Y157 (= Y154), K161 (= K158), G188 (= G185), G189 (≠ S186), T190 (= T187), T192 (= T189), M194 (= M191)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ S186), F195 (≠ N192), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ T206), A218 (= A207)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
41% identity, 99% coverage: 2:243/245 of query aligns to 5:259/260 of 3qwiA
- active site: G19 (= G16), S143 (= S140), N144 (= N141), H154 (≠ F151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ A146), G189 (≠ S186), M194 (= M191), Y202 (vs. gap), I203 (vs. gap), A218 (= A207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (= S39), I67 (≠ N64), N93 (= N90), S94 (≠ A91), G95 (= G92), L116 (≠ V113), T141 (≠ I138), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (≠ S186), T190 (= T187), T192 (= T189), M194 (= M191)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
41% identity, 99% coverage: 2:243/245 of query aligns to 5:259/260 of 3qwhA
- active site: G19 (= G16), S143 (= S140), N144 (= N141), H154 (≠ F151), Y157 (= Y154), K161 (= K158), Y202 (vs. gap)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (= N141), F149 (≠ A146), G189 (≠ S186), F195 (≠ N192), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), A218 (= A207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), G19 (= G16), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (= S39), D66 (= D63), I67 (≠ N64), N93 (= N90), S94 (≠ A91), G95 (= G92), L116 (≠ V113), T141 (≠ I138), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), G189 (≠ S186), T190 (= T187), T192 (= T189), M194 (= M191)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
41% identity, 99% coverage: 2:243/245 of query aligns to 4:258/259 of 4fj1B
- active site: G18 (= G16), S142 (= S140), N143 (= N141), H153 (≠ F151), Y156 (= Y154), K160 (= K158), Y201 (vs. gap)
- binding genistein: G188 (≠ S186), F194 (≠ N192), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ T206), A217 (= A207)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G12), R17 (= R15), G18 (= G16), I19 (= I17), A39 (= A37), N40 (≠ S38), S41 (= S39), I66 (≠ N64), N92 (= N90), S93 (≠ A91), G94 (= G92), L115 (≠ V113), T140 (≠ I138), S142 (= S140), Y156 (= Y154), K160 (= K158), G187 (= G185), T189 (= T187), T191 (= T189), M193 (= M191)
8hfjC Crystal structure of cbar mutant (h162f) in complex with NADP+ and a bulky 1,3-cyclodiketone (see paper)
38% identity, 99% coverage: 2:243/245 of query aligns to 5:259/260 of 8hfjC
- binding 2-methyl-2-[(4-methylphenyl)methyl]cyclopentane-1,3-dione: N144 (= N141), T145 (≠ V142), F154 (= F151), G189 (≠ S186), V198 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), Y39 (= Y36), A40 (= A37), N41 (≠ S38), S42 (= S39), D66 (= D63), V67 (≠ N64), N93 (= N90), S94 (≠ A91), L116 (≠ V113), T141 (≠ I138), Y157 (= Y154), K161 (= K158), P187 (= P184), T190 (= T187), T192 (= T189), M194 (= M191)
Sites not aligning to the query:
P39333 Cyclic-di-GMP-binding biofilm dispersal mediator protein from Escherichia coli (strain K12) (see paper)
42% identity, 97% coverage: 3:240/245 of query aligns to 4:232/237 of P39333
- E50 (= E49) mutation E->Q,V: Shows higher affinity for cyclic-di-GMP, increases swimming motility and biofilm dispersal. Biofilm formation is almost completely removed.
5z2lK Crystal structure of bdca in complex with NADPH (see paper)
42% identity, 97% coverage: 3:240/245 of query aligns to 3:231/244 of 5z2lK
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S14 (= S14), R15 (= R15), I17 (= I17), Y36 (= Y36), A37 (= A37), G38 (≠ S38), S39 (= S39), T57 (≠ A62), D58 (= D63), S59 (≠ N64), N81 (= N90), A82 (= A91), G83 (= G92), I129 (= I138), S131 (= S140), Y145 (= Y154), K149 (= K158), P175 (= P184), I178 (≠ T187), T180 (= T189), A182 (≠ M191), N183 (= N192)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
38% identity, 99% coverage: 2:243/245 of query aligns to 5:258/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S140), N144 (= N141), T145 (≠ V142), F153 (= F151), Y156 (= Y154), G187 (= G185), M193 (= M191), V197 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G12), R18 (= R15), I20 (= I17), A40 (= A37), N41 (≠ S38), S42 (= S39), D66 (= D63), N93 (= N90), S94 (≠ A91), L116 (≠ V113), T141 (≠ I138), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), G188 (≠ S186), T189 (= T187), T191 (= T189), M193 (= M191)
Sites not aligning to the query:
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
38% identity, 99% coverage: 2:243/245 of query aligns to 9:263/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S140), Y161 (= Y154), G193 (≠ S186), M198 (= M191), F199 (≠ N192), V202 (vs. gap), S203 (vs. gap), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G12), R22 (= R15), G23 (= G16), I24 (= I17), Y43 (= Y36), A44 (= A37), N45 (≠ S38), S46 (= S39), D70 (= D63), V71 (≠ N64), N97 (= N90), S98 (≠ A91), L120 (≠ V113), T145 (≠ I138), S147 (= S140), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), T194 (= T187), T196 (= T189), M198 (= M191)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 99% coverage: 2:244/245 of query aligns to 8:253/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), S20 (= S14), K21 (≠ R15), G22 (= G16), I23 (= I17), A43 (= A37), S44 (= S38), S45 (= S39), G68 (≠ A62), D69 (= D63), V70 (≠ N64), N96 (= N90), S97 (≠ A91), G98 (= G92), Y100 (≠ F94), I144 (= I138), S146 (= S140), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), M191 (≠ S186), I192 (≠ T187), T194 (= T189), G196 (≠ M191), T197 (≠ N192)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S140), Y159 (= Y154), M191 (≠ S186), I202 (≠ P197)
6yq3AAA Monooxygenase (see paper)
42% identity, 95% coverage: 2:234/245 of query aligns to 2:240/252 of 6yq3AAA
- active site: G16 (= G16), S146 (= S140), Y159 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), G16 (= G16), I17 (= I17), H35 (≠ T35), A37 (= A37), S38 (= S38), N39 (≠ S39), L64 (vs. gap), N96 (= N90), A97 (= A91), A98 (≠ G92), V119 (= V113), I144 (= I138), Y159 (= Y154), K163 (= K158), P189 (= P184), G190 (= G185), I191 (≠ S186), T192 (= T187), N194 (≠ T189)
- binding (3~{R})-8-methoxy-3-methyl-3,6-bis(oxidanyl)-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: S146 (= S140), G147 (≠ N141), L148 (≠ V142), Q156 (≠ F151), Y159 (= Y154), I191 (≠ S186)
Sites not aligning to the query:
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
40% identity, 97% coverage: 6:242/245 of query aligns to 5:243/246 of 3osuA
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
41% identity, 97% coverage: 6:242/245 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 9:36, 57% identical) binding
- D59 (= D63) binding
- K156 (= K158) binding
6yq0AAA Monooxygenase (see paper)
42% identity, 95% coverage: 2:234/245 of query aligns to 2:242/254 of 6yq0AAA
- active site: G16 (= G16), S148 (= S140), Y161 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), G16 (= G16), I17 (= I17), H35 (≠ T35), A37 (= A37), S38 (= S38), N39 (≠ S39), L64 (vs. gap), N96 (= N90), A97 (= A91), A98 (vs. gap), T100 (vs. gap), R117 (≠ A109), I146 (= I138), S147 (≠ G139), S148 (= S140), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), I193 (≠ S186), T194 (= T187), N196 (≠ T189)
- binding (3~{R})-8-methoxy-3-methyl-3-oxidanyl-2,4-dihydrobenzo[a]anthracene-1,7,12-trione: T100 (vs. gap), G101 (= G92), S148 (= S140), G149 (≠ N141), L150 (≠ V142), C153 (≠ V145), Q158 (≠ F151), Y161 (= Y154), G192 (= G185), I193 (≠ S186)
Sites not aligning to the query:
6ypzAAA Monooxygenase (see paper)
42% identity, 95% coverage: 2:234/245 of query aligns to 2:242/253 of 6ypzAAA
- active site: G16 (= G16), S148 (= S140), Y161 (= Y154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (= R15), G16 (= G16), I17 (= I17), H35 (≠ T35), A37 (= A37), S38 (= S38), N39 (≠ S39), L64 (vs. gap), N96 (= N90), A97 (= A91), A98 (vs. gap), T100 (vs. gap), I146 (= I138), S147 (≠ G139), S148 (= S140), Y161 (= Y154), K165 (= K158), P191 (= P184), G192 (= G185), I193 (≠ S186), T194 (= T187), N196 (≠ T189)
Query Sequence
>Ga0059261_3382 FitnessBrowser__Korea:Ga0059261_3382
MRLDGKRALVTGGSRGIGAAIARRLAREGADVAITYASSAGAAAGVAAEIEALGRRALAI
TADNRDAAAVEAAVDQAAAALGGIDILVNNAGIFLAAPADDLSLEDFDATMAVNLRAPFV
AVRAVLPHMGEGGRIVAIGSNVALVAPTPGFSVYSTSKAAVTMLHQALARDLAPRGITVN
TVHPGSTDTDMNPADGPHAADQIARTALGRFGSADDIASAVAYLASPEARSVTGTALLVD
SGANA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory