Comparing Ga0059261_3508 FitnessBrowser__Korea:Ga0059261_3508 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
84% identity, 100% coverage: 1:417/417 of query aligns to 1:420/420 of Q93UV0
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
87% identity, 95% coverage: 20:416/417 of query aligns to 2:398/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
87% identity, 95% coverage: 20:416/417 of query aligns to 2:398/398 of 2w8jA
4bmkA Serine palmitoyltransferase k265a from s. Paucimobilis with bound plp- myriocin aldimine (see paper)
87% identity, 95% coverage: 20:416/417 of query aligns to 2:398/398 of 4bmkA
2x8uA Sphingomonas wittichii serine palmitoyltransferase (see paper)
79% identity, 95% coverage: 20:416/417 of query aligns to 2:398/399 of 2x8uA
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/392 of 3a2bA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
37% identity, 86% coverage: 50:409/417 of query aligns to 31:392/394 of 8guhA
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
37% identity, 86% coverage: 58:416/417 of query aligns to 41:400/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
37% identity, 86% coverage: 58:416/417 of query aligns to 38:397/398 of P0AB77
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
34% identity, 86% coverage: 56:415/417 of query aligns to 279:636/653 of Q5W264
Sites not aligning to the query:
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
34% identity, 88% coverage: 51:416/417 of query aligns to 27:396/396 of 3tqxA
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
32% identity, 88% coverage: 51:416/417 of query aligns to 30:399/400 of 7v58B
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
33% identity, 88% coverage: 51:416/417 of query aligns to 30:399/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
33% identity, 88% coverage: 51:416/417 of query aligns to 30:399/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
33% identity, 88% coverage: 51:416/417 of query aligns to 30:399/399 of 7bxqA
>Ga0059261_3508 FitnessBrowser__Korea:Ga0059261_3508
MTDSIATPDAPTIPAGAKPDLMSKFDGLIAERQALLDSGVTDPFAIVMDQVKSPTEAVIK
GKDTILLGTYNYMGMTFDPDVIQAGKDALDQFGSGTNGSRMLNGTFRDHMEVEQALRDFY
GTTGAIVFSTGYMANLGMISTLAGKGDYIILDADSHASIYDGCKQGYAEIVRFRHNSVED
LDKRLGRLPAEAGKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLSDEAHSMGFFGPNG
RGVYEAQGCEGDVDFIVGTFSKSVGTVGGFCVSNHPKFEAIRLACRQYIFTASLPPSVVA
TAATSIRKLQHAHNKRQHLWENARAVHSGLKEMGFKLGTETCDSAIIAVILTDQEQAVTM
WQALLDNGLYVNMARPPATPAGTFLLRCSLCAEHTPEQVQRILAMFRAAGQAVGVIG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory