Comparing Ga0059261_3512 FitnessBrowser__Korea:Ga0059261_3512 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
39% identity, 96% coverage: 12:364/367 of query aligns to 5:362/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
39% identity, 96% coverage: 12:364/367 of query aligns to 7:364/367 of P0A7B5
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
35% identity, 96% coverage: 12:364/367 of query aligns to 5:322/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
34% identity, 96% coverage: 12:364/367 of query aligns to 5:320/323 of 2j5vA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 63% coverage: 10:242/367 of query aligns to 1:219/241 of 2akoA
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
34% identity, 64% coverage: 11:246/367 of query aligns to 14:241/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 65% coverage: 11:248/367 of query aligns to 14:221/236 of 7f5xA
8u0mA Isopentenyl phosphate kinase (see paper)
24% identity, 47% coverage: 12:185/367 of query aligns to 3:179/247 of 8u0mA
Sites not aligning to the query:
8u0mB Isopentenyl phosphate kinase (see paper)
24% identity, 47% coverage: 12:185/367 of query aligns to 4:180/247 of 8u0mB
Sites not aligning to the query:
8u0lA Isopentenyl phosphate kinase (see paper)
24% identity, 47% coverage: 12:185/367 of query aligns to 3:180/247 of 8u0lA
Sites not aligning to the query:
8u0kA Isopentenyl phosphate kinase (see paper)
24% identity, 47% coverage: 12:185/367 of query aligns to 3:180/247 of 8u0kA
Sites not aligning to the query:
8u0nA Isopentenyl phosphate kinase (see paper)
24% identity, 47% coverage: 12:185/367 of query aligns to 3:178/245 of 8u0nA
Sites not aligning to the query:
>Ga0059261_3512 FitnessBrowser__Korea:Ga0059261_3512
MHLFPPASCPRLVVKIGSALLVDPEGAIRRDWLEGIAADIAARVRAGQQIAVVSSGAIAL
GARRLKLAKGGRASLEDAQAAAATGQIALSQVWAEVLAANGLTAAQMLVTLDDLEDRRRY
LNAAATLGRLLSLGVVPVINENDSVATAEIRFGDNDRLAARVAQAADASGVVLLSDIDGL
YDRNPALPGAVHIPVVERIDGRVEGMADRGSASGMGSGGMVSKIEAARIAASAGVSLAIA
NGRVDRPLSADARHTVFLPEKRTRARKAWLAGRLTAKGSIIVDAGAAQALTEGRSLLAIG
ATAIRGMFFRGDLVTIEGPNGPIARGLSEYDAPDAQAILGTRSDDQGEILGYAPRSTLVH
RNHMALL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory