Comparing Ga0059261_3603 FitnessBrowser__Korea:Ga0059261_3603 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 97% coverage: 1:268/275 of query aligns to 37:305/307 of Q94JV5
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
33% identity, 96% coverage: 2:266/275 of query aligns to 7:302/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
33% identity, 96% coverage: 2:266/275 of query aligns to 4:299/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
33% identity, 96% coverage: 2:266/275 of query aligns to 4:299/304 of 4hg3A
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
33% identity, 96% coverage: 2:266/275 of query aligns to 3:295/299 of 4hgdA
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
30% identity, 97% coverage: 1:267/275 of query aligns to 4:266/276 of Q9NQR4
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
29% identity, 94% coverage: 1:259/275 of query aligns to 2:249/254 of 4izuA
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
30% identity, 88% coverage: 1:242/275 of query aligns to 10:240/263 of 4iztA
5nycA A c145a mutant of nesterenkonia an1 amidase bound to propionitrile
29% identity, 94% coverage: 1:259/275 of query aligns to 9:256/261 of 5nycA
4izsA The c145a mutant of the amidase from nesterenkonia sp. An1 in complex with butyramide
29% identity, 94% coverage: 1:259/275 of query aligns to 9:256/261 of 4izsA
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
30% identity, 88% coverage: 1:242/275 of query aligns to 9:239/262 of 5nybA
5ny7A A c145a mutant of nesterenkonia an1 amidase bound to nicotinamide
30% identity, 88% coverage: 1:242/275 of query aligns to 9:239/262 of 5ny7A
Sites not aligning to the query:
Q9RQ17 Aliphatic amidase; Acylamide amidohydrolase; Wide spectrum amidase; EC 3.5.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
26% identity, 92% coverage: 13:264/275 of query aligns to 30:275/348 of Q9RQ17
Sites not aligning to the query:
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 93% coverage: 1:256/275 of query aligns to 1:243/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
28% identity, 93% coverage: 1:256/275 of query aligns to 1:243/261 of 3klcA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
28% identity, 93% coverage: 1:256/275 of query aligns to 2:244/262 of Q9UYV8
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
29% identity, 89% coverage: 12:257/275 of query aligns to 32:267/339 of O25067
4gylA The e142l mutant of the amidase from geobacillus pallidus showing the result of michael addition of acrylamide at the active site cysteine (see paper)
27% identity, 92% coverage: 13:264/275 of query aligns to 30:275/340 of 4gylA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
28% identity, 90% coverage: 1:248/275 of query aligns to 9:243/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
28% identity, 90% coverage: 1:248/275 of query aligns to 3:237/263 of 7ovgA
>Ga0059261_3603 FitnessBrowser__Korea:Ga0059261_3603
MRAAILQMTSGIDALANAATLADGVAKASAGGAAMLFTPEMSGLLDRQRERAAANIVLES
EDRVLAAVREAAAKHGVWVHLGSLALKGEADGRFVNRGFVIDGSGEIRARYDKLHLFDVD
LPTGERWRESDAYAPGASAAVVGTPLGKLGLAICYDLRFPDLFRALTDAGATLLAVPAAF
TRPTGQAHWHVLLRARAIEAGVHVIAAAQTGEHEDGRATYGHSVAIDPWGEVLLDMGEGA
GLGFAEIDPARVADVRSRVPAIAHRRAIPPVAVIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory