Comparing Ga0059261_3619 FitnessBrowser__Korea:Ga0059261_3619 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a9vA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 8a9vA
7zzjA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 7zzjA
7zzgA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 7zzgA
7zzeA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 7zzeA
7zzcA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 7zzcA
7zzaA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 7zzaA
6z61A Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a di-adenosine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6z61A
6rr2A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rr2A
6rgfA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with an inhibitor
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rgfA
6rgbA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an inhibitor (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rgbA
6rc5A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rc5A
6rc4A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rc4A
6rc2A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rc2A
6rbxA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rbxA
6rbwA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rbwA
6rbuA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rbuA
6rbtA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rbtA
6rbsA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rbsA
6rbqA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 6rbqA
3v7uA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with mta (see paper)
27% identity, 82% coverage: 24:234/257 of query aligns to 24:239/261 of 3v7uA
>Ga0059261_3619 FitnessBrowser__Korea:Ga0059261_3619
MSGIRRALVASPTNPAEVAAHELLAAHDWVHPDEAEMIVALGGDGFMLQTLHMLLEKHRN
LPVFGMNLGTIGFLMNEWRPDGLDARLARARPFRVTPLVMTATTVEGDTHVLPAINEVSL
LRETRQTAKLEVTVNDRIVLPELVCDGILVATPAGSTAYNLSAHGPILPLGSQMLALTPI
SPFRPRRWRGAILPEKTRISLQVLDPGKRPVSAVADQREVRDVARVDIEIDPKRDLTLLF
DPEHALDDRITMEQFVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory