SitesBLAST
Comparing Ga0059261_3648 FitnessBrowser__Korea:Ga0059261_3648 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P97852 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Rattus norvegicus (Rat) (see paper)
50% identity, 99% coverage: 3:298/298 of query aligns to 5:301/735 of P97852
- 16:40 (vs. 14:38, 84% identical) binding
1gz6A (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
50% identity, 99% coverage: 3:298/298 of query aligns to 3:299/301 of 1gz6A
- active site: S149 (= S151), Y162 (= Y164), K166 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), L19 (= L19), D38 (= D38), L39 (= L39), S73 (= S72), V74 (= V73), N97 (= N99), A98 (= A100), G99 (= G101), I100 (≠ V102), H121 (= H123), T147 (= T149), S149 (= S151), Y162 (= Y164), K166 (= K168), P192 (= P194), A194 (= A196), S196 (≠ T198), R197 (= R199), M198 (= M200)
1zbqA Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type 4 in complex with NAD
49% identity, 99% coverage: 3:298/298 of query aligns to 3:299/302 of 1zbqA
- active site: S149 (= S151), Y162 (= Y164), K166 (= K168)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), G18 (= G18), L19 (= L19), D38 (= D38), L39 (= L39), S73 (= S72), V74 (= V73), N97 (= N99), A98 (= A100), T147 (= T149), S149 (= S151), Y162 (= Y164), K166 (= K168), P192 (= P194), N193 (≠ T195), A194 (= A196), S196 (≠ T198), R197 (= R199), M198 (= M200)
P51659 Peroxisomal multifunctional enzyme type 2; MFE-2; 17-beta-hydroxysteroid dehydrogenase 4; 17-beta-HSD 4; D-bifunctional protein; DBP; Multifunctional protein 2; MFP-2; Short chain dehydrogenase/reductase family 8C member 1; EC 1.1.1.n12; EC 4.2.1.107; EC 4.2.1.119 from Homo sapiens (Human) (see 5 papers)
49% identity, 99% coverage: 3:298/298 of query aligns to 5:301/736 of P51659
- G16 (= G14) to S: in DBPD; no dehydrogenase activity; dbSNP:rs137853096
- R106 (≠ K106) to H: in dbSNP:rs25640
Sites not aligning to the query:
- 347 Y→A: No hydratase activity.
- 366 E→A: No hydratase activity.
- 370 D→A: No effect.
- 406 H→A: No effect.
- 408 E→A: No effect.
- 410 Y→A: No effect.
- 457 N → Y: in DBPD; the mutation leads to an unstable protein; dbSNP:rs137853097
- 490 D→A: No effect.
- 505 Y→A: Completely inactive.
- 510 D→A: No hydratase activity.
- 511 W → R: in dbSNP:rs11539471
- 515 H→A: Completely inactive.
- 517 D→A: No effect.
- 532 H→A: No effect.
- 559 I → V: in dbSNP:rs11205
1gz6B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 (see paper)
48% identity, 99% coverage: 3:298/298 of query aligns to 3:276/278 of 1gz6B
- active site: S141 (= S151), Y154 (= Y164), K158 (= K168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), L19 (= L19), D38 (= D38), L39 (= L39), S65 (= S72), V66 (= V73), N89 (= N99), A90 (= A100), G91 (= G101), H113 (= H123), T139 (= T149), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194)
P96825 Putative short-chain type dehydrogenase/reductase Rv0148; EC 1.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
48% identity, 91% coverage: 8:278/298 of query aligns to 7:278/286 of P96825
Sites not aligning to the query:
- 280 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P22414 Peroxisomal hydratase-dehydrogenase-epimerase; HDE; Multifunctional beta-oxidation protein; MFP; EC 4.2.1.119; EC 1.1.1.n12 from Candida tropicalis (Yeast) (see paper)
47% identity, 92% coverage: 3:275/298 of query aligns to 4:276/906 of P22414
Sites not aligning to the query:
- 699 binding
- 700 binding
- 729 binding
- 757 binding
- 808 binding
- 810 binding
- 831 binding
- 856 binding
- 857 binding
- 858 binding
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
41% identity, 62% coverage: 9:194/298 of query aligns to 3:181/244 of 1edoA
- active site: G12 (= G18), S138 (= S151), Y151 (= Y164), K155 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ G16), R11 (≠ G17), I13 (≠ L19), N31 (= N37), Y32 (≠ D38), A33 (≠ L39), R34 (≠ G40), S35 (≠ G41), D59 (≠ S72), V60 (= V73), N86 (= N99), A87 (= A100), S138 (= S151), Y151 (= Y164), K155 (= K168), P181 (= P194)
Sites not aligning to the query:
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
40% identity, 75% coverage: 8:230/298 of query aligns to 7:229/247 of P73574
- A14 (= A15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ F159) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K168) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ T195) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ F205) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 76% coverage: 4:230/298 of query aligns to 4:228/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ H123), S139 (= S151), Q149 (= Q161), Y152 (= Y164), K156 (= K168)
- binding acetoacetyl-coenzyme a: D93 (= D105), K98 (≠ N110), S139 (= S151), N146 (= N158), V147 (≠ F159), Q149 (= Q161), Y152 (= Y164), F184 (≠ T195), M189 (= M200), K200 (≠ A212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ G17), G18 (= G18), I19 (≠ L19), D38 (= D38), F39 (≠ L39), V59 (≠ G70), D60 (≠ S72), V61 (= V73), N87 (= N99), A88 (= A100), G89 (= G101), I90 (≠ V102), T137 (= T149), S139 (= S151), Y152 (= Y164), K156 (= K168), P182 (= P194), F184 (≠ T195), T185 (≠ A196), T187 (= T198), M189 (= M200)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 77% coverage: 3:231/298 of query aligns to 1:228/244 of 6t77A
- active site: G16 (= G18), S138 (= S151), Y151 (= Y164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (≠ G17), T37 (≠ H48), L58 (≠ N69), N59 (≠ S72), V60 (= V73), A87 (= A100), G88 (= G101), I89 (≠ V102)
7lgbA Chsb1 in complex with NAD+ (see paper)
38% identity, 75% coverage: 5:227/298 of query aligns to 3:228/282 of 7lgbA
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), L17 (= L19), D36 (= D38), V37 (≠ L39), G64 (vs. gap), D65 (≠ S72), I66 (≠ V73), N91 (= N99), A92 (= A100), G93 (= G101), I94 (≠ V102), V114 (= V122), T149 (= T149), S151 (= S151), Y164 (= Y164), K168 (= K168), P194 (= P194), T198 (= T198), M200 (= M200), T201 (= T201)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 77% coverage: 3:230/298 of query aligns to 1:227/244 of P0AEK2
- GASR 12:15 (≠ GAGG 14:17) binding
- T37 (≠ H48) binding
- NV 59:60 (≠ SV 72:73) binding
- N86 (= N99) binding
- Y151 (= Y164) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YGAAK 164:168) binding
- A154 (= A167) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K168) mutation to A: Defect in the affinity for NADPH.
- I184 (vs. gap) binding
Sites not aligning to the query:
- 233 E→K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
36% identity, 76% coverage: 5:230/298 of query aligns to 2:226/243 of 1q7bA
- active site: G15 (= G18), E101 (≠ D115), S137 (= S151), Q147 (= Q161), Y150 (= Y164), K154 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ G16), R14 (≠ G17), T36 (≠ H48), N58 (≠ S72), V59 (= V73), N85 (= N99), A86 (= A100), G87 (= G101), I88 (≠ V102), S137 (= S151), Y150 (= Y164), K154 (= K168), P180 (= P194), G181 (vs. gap), I183 (vs. gap)
Sites not aligning to the query:
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
36% identity, 76% coverage: 4:230/298 of query aligns to 2:223/239 of 4nbtA
- active site: G16 (= G18), S132 (= S151), Y145 (= Y164), K149 (= K168)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), K15 (≠ G17), G16 (= G18), L17 (= L19), D36 (= D38), L37 (= L39), L52 (≠ V56), N53 (≠ S72), V54 (= V73), N80 (= N99), A81 (= A100), G82 (= G101), I130 (≠ T149), S132 (= S151), Y145 (= Y164), K149 (= K168), P177 (= P194), G178 (= G197), I180 (≠ R199), T182 (= T201)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 75% coverage: 5:228/298 of query aligns to 3:229/247 of 4jroC
- active site: G16 (= G18), S142 (= S151), Q152 (= Q161), Y155 (= Y164), K159 (= K168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ G16), R15 (≠ G17), G16 (= G18), I17 (≠ L19), N35 (= N37), Y36 (≠ G45), N37 (≠ T46), G38 (= G47), S39 (≠ H48), N63 (≠ S72), V64 (= V73), N90 (= N99), A91 (= A100), I93 (≠ V102), I113 (≠ V122), S142 (= S151), Y155 (= Y164), K159 (= K168), P185 (= P194), I188 (≠ G197), T190 (≠ R199)
7x5jC Acp-dependent oxoacyl reductase
37% identity, 79% coverage: 8:243/298 of query aligns to 5:254/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ G16), G15 (= G18), L16 (= L19), N36 (≠ T46), R37 (≠ G47), N38 (≠ H48), D62 (≠ S72), V63 (= V73), N89 (= N99), A90 (= A100), A91 (vs. gap), V114 (= V122), I141 (≠ T149), Y156 (= Y164), K160 (= K168), L186 (≠ P194), G187 (vs. gap), V188 (≠ T195), R194 (≠ T201), S197 (vs. gap), S198 (vs. gap)
O53547 Hydroxyacyl-CoA dehydrogenase ChsB1; EC 1.1.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 75% coverage: 5:227/298 of query aligns to 18:250/317 of O53547
- L32 (= L19) binding
- D51 (= D38) binding
- D82 (≠ S72) binding
- I83 (≠ V73) binding
- N108 (= N99) binding
- S168 (= S151) binding
- Y181 (= Y164) binding
- K185 (= K168) binding
- T215 (= T198) binding
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 76% coverage: 5:230/298 of query aligns to 2:226/243 of 1q7cA
- active site: G15 (= G18), S137 (= S151), Q147 (= Q161), F150 (≠ Y164), K154 (= K168)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ G16), R14 (≠ G17), A35 (≠ G47), T36 (≠ H48), L57 (≠ N69), N58 (≠ S72), V59 (= V73), G87 (= G101), I88 (≠ V102)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 77% coverage: 3:230/298 of query aligns to 4:230/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ G16), R18 (≠ G17), I20 (≠ L19), T40 (≠ H48), N62 (≠ S72), V63 (= V73), N89 (= N99), A90 (= A100), I92 (≠ V102), V139 (≠ T149), S141 (= S151), Y154 (= Y164), K158 (= K168), P184 (= P194), G185 (vs. gap), I187 (≠ A196), T189 (= T198), M191 (= M200)
Query Sequence
>Ga0059261_3648 FitnessBrowser__Korea:Ga0059261_3648
MAIRFDGRVAIVTGAGGGLGRAYALELARRGARVVVNDLGGSRDGTGHSDAAAKVVEEIE
ALGGEALANGGSVTDYAQMEAMVAAAKEKWGGVHILINNAGVLRDKSFANMEPEDFRFVV
DVHLNGSANVTKAVWSTMRDQNYGRILMTASSTGLYGNFGQANYGAAKLGLAGLTKTLYL
EGAKYDIRVNTIAPTAGTRMTEDIFPEAAFQAFTPESVAPAALFLVSEDAPTNMIVGAGA
GVFQAAYITLTPGVRLEGEDLTPEGIAANWSAITDRMGEIVPKSGGEQAMTIMAKLQR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory