Comparing Ga0059261_3672 FitnessBrowser__Korea:Ga0059261_3672 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1djeA Crystal structure of the plp-bound form of 8-amino-7-oxonanoate synthase (see paper)
36% identity, 96% coverage: 14:368/369 of query aligns to 27:379/383 of 1djeA
1dj9A Crystal structure of 8-amino-7-oxonanoate synthase (or 7-keto- 8aminipelargonate or kapa synthase) complexed with plp and the product 8(s)-amino-7-oxonanonoate (or kapa). The enzyme of biotin biosynthetic pathway. (see paper)
36% identity, 96% coverage: 14:368/369 of query aligns to 27:379/383 of 1dj9A
Sites not aligning to the query:
2g6wA Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine (see paper)
36% identity, 96% coverage: 14:368/369 of query aligns to 27:379/383 of 2g6wA
P12998 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; EC 2.3.1.47 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 96% coverage: 14:368/369 of query aligns to 28:380/384 of P12998
Sites not aligning to the query:
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
33% identity, 98% coverage: 7:369/369 of query aligns to 13:388/398 of 7poaA
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
32% identity, 97% coverage: 11:368/369 of query aligns to 28:390/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 11:368/369 of query aligns to 25:387/398 of P0AB77
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/392 of 3a2bA
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
31% identity, 96% coverage: 10:363/369 of query aligns to 15:380/394 of 8guhA
Q8GW43 8-amino-7-oxononanoate synthase; AONS; 7-keto-8-amino-pelargonic acid synthase; 7-KAP synthase; KAPA synthase; 8-amino-7-ketopelargonate synthase; Biotin synthase 4; Biotin synthase F; AtbioF; EC 2.3.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 95% coverage: 17:368/369 of query aligns to 99:455/476 of Q8GW43
Sites not aligning to the query:
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
29% identity, 98% coverage: 9:368/369 of query aligns to 11:386/396 of 3tqxA
2bwoB 5-aminolevulinate synthase from rhodobacter capsulatus in complex with succinyl-coa (see paper)
31% identity, 97% coverage: 10:368/369 of query aligns to 11:393/399 of 2bwoB
2bwpA 5-aminolevulinate synthase from rhodobacter capsulatus in complex with glycine (see paper)
31% identity, 97% coverage: 10:368/369 of query aligns to 11:393/398 of 2bwpA
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
33% identity, 87% coverage: 30:351/369 of query aligns to 52:377/429 of 6hrhA
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
33% identity, 87% coverage: 30:351/369 of query aligns to 52:377/429 of 5qreA
Sites not aligning to the query:
>Ga0059261_3672 FitnessBrowser__Korea:Ga0059261_3672
VSGDFHRGDLERLRNAGRYRSLTPRTGIDFASNDYLGLANDQRLRDAVAAALDRGLAVGS
GGSRLLRGNDPEIATLEAEAAAMFRAEAALFFSTGFAANVALLATLPQPGDLIVHDALIH
ASVHDGLKLSRAPSVAAAHNDAQAVDDAIASWRGQGGAGTPWIAVESLYSMDGDRAPIAA
LAEVAARHDAMLIIDEAHATGIWGNGGRGLAATLEGQPNIITLHTCGKALGCEGALVCGA
RVFIDFLVNRARPFIFSTAPSPLMAAAVREALRIVADEPARRETLHWLIAHAERVLAPLG
VTPTGSQVLPLIVGGDAETMARAAALQAKGFDVRGIRPPTVPAGTARLRISLTLNVTQGD
IDRLADALK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory