SitesBLAST
Comparing Ga0059261_3674 FitnessBrowser__Korea:Ga0059261_3674 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
40% identity, 100% coverage: 1:414/415 of query aligns to 8:422/429 of 6ed7A
- active site: Y17 (≠ F10), Y144 (= Y137), D245 (= D232), K274 (= K261)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ F10), W52 (= W45), W52 (= W45), Y144 (= Y137), D147 (= D140), A217 (= A204), K274 (= K261), R391 (= R383), F393 (≠ L385), F393 (≠ L385)
- binding pyridoxal-5'-phosphate: G112 (= G105), S113 (= S106), Y144 (= Y137), H145 (= H138), D245 (= D232), I247 (≠ V234), K274 (= K261)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
40% identity, 100% coverage: 1:414/415 of query aligns to 8:422/429 of P12995
- Y17 (≠ F10) mutation to F: Severely reduces the aminotransferase activity.
- W52 (= W45) binding
- GS 112:113 (= GS 105:106) binding
- Y144 (= Y137) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D140) mutation to N: Loss of aminotransferase activity.
- D245 (= D232) binding
- R253 (= R240) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K261) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (≠ S295) binding
- PT 308:309 (≠ SS 296:297) binding
- R391 (= R383) binding ; mutation to A: Reduces aminotransferase activity.
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
40% identity, 100% coverage: 1:414/415 of query aligns to 8:421/427 of 1mlzA
- active site: Y17 (≠ F10), Y144 (= Y137), E210 (= E198), D244 (= D232), A247 (≠ M235), K273 (= K261), Y397 (= Y390)
- binding pyridoxal-5'-phosphate: G112 (= G105), S113 (= S106), Y144 (= Y137), H145 (= H138), D244 (= D232), I246 (≠ V234), K273 (= K261), P307 (≠ S296), T308 (≠ S297)
- binding trans-amiclenomycin: W52 (= W45), W53 (= W46), Y144 (= Y137), K273 (= K261), R390 (= R383), F392 (≠ L385)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
40% identity, 100% coverage: 1:414/415 of query aligns to 8:421/427 of 1mlyA
- active site: Y17 (≠ F10), Y144 (= Y137), E210 (= E198), D244 (= D232), A247 (≠ M235), K273 (= K261), Y397 (= Y390)
- binding cis-amiclenomycin: W52 (= W45), W53 (= W46), K273 (= K261), R390 (= R383), F392 (≠ L385)
- binding pyridoxal-5'-phosphate: G112 (= G105), S113 (= S106), Y144 (= Y137), H145 (= H138), D244 (= D232), I246 (≠ V234), K273 (= K261), P307 (≠ S296), T308 (≠ S297)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
40% identity, 99% coverage: 6:414/415 of query aligns to 13:422/429 of 1dtyA
- active site: Y17 (≠ F10), Y144 (= Y137), E211 (= E198), D245 (= D232), A248 (≠ M235), K274 (= K261), Y398 (= Y390)
- binding pyridoxal-5'-phosphate: G112 (= G105), S113 (= S106), Y144 (= Y137), H145 (= H138), D245 (= D232), I247 (≠ V234), K274 (= K261)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
40% identity, 100% coverage: 1:414/415 of query aligns to 8:410/416 of 1qj3A
- active site: Y17 (≠ F10), Y144 (= Y137), E201 (= E198), D235 (= D232), A238 (≠ M235), K264 (= K261), Y386 (= Y390)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ F10), W52 (= W45), Y144 (= Y137), K264 (= K261), R379 (= R383), F381 (≠ L385)
- binding pyridoxal-5'-phosphate: G112 (= G105), S113 (= S106), Y144 (= Y137), H145 (= H138), G146 (= G139), D235 (= D232), I237 (≠ V234), A238 (≠ M235), K264 (= K261)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
36% identity, 98% coverage: 6:413/415 of query aligns to 13:440/448 of 3du4A
- active site: F17 (= F10), Y146 (= Y137), E217 (= E198), D251 (= D232), A254 (≠ M235), K280 (= K261), A417 (≠ Y390)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A74), Y146 (= Y137), G315 (≠ S295), S317 (= S297), R410 (= R383)
- binding pyridoxal-5'-phosphate: S112 (= S104), G113 (= G105), A114 (≠ S106), Y146 (= Y137), H147 (= H138), E217 (= E198), D251 (= D232), V253 (= V234), A254 (≠ M235), K280 (= K261), H316 (≠ S296), S317 (= S297)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
36% identity, 98% coverage: 6:413/415 of query aligns to 13:440/448 of P53555
- GA 113:114 (≠ GS 105:106) binding
- Y146 (= Y137) binding
- K280 (= K261) modified: N6-(pyridoxal phosphate)lysine
- G315 (≠ S295) binding
- HS 316:317 (≠ SS 296:297) binding
- R410 (= R383) binding
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
34% identity, 98% coverage: 1:405/415 of query aligns to 9:405/420 of 6erkA
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
34% identity, 99% coverage: 6:414/415 of query aligns to 13:434/438 of 6zhkA
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:418/425 of 4w1vA
- active site: Y18 (≠ F10), Y147 (= Y137), E210 (= E198), D244 (= D232), A247 (≠ M235), K273 (= K261), Y397 (= Y390)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P9), Y18 (≠ F10), W54 (= W45), M81 (≠ I72), G83 (≠ A74), Y147 (= Y137), G306 (≠ S295), P307 (≠ S296), T308 (≠ S297), F392 (≠ L385)
- binding pyridoxal-5'-phosphate: G114 (= G105), S115 (= S106), Y147 (= Y137), H148 (= H138), E210 (= E198), D244 (= D232), I246 (≠ V234), K273 (= K261)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:418/425 of 4cxrA
- active site: Y18 (≠ F10), Y147 (= Y137), E210 (= E198), D244 (= D232), A247 (≠ M235), K273 (= K261), Y397 (= Y390)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F10), W54 (= W45), W55 (= W46), A216 (= A204)
- binding pyridoxal-5'-phosphate: G114 (= G105), S115 (= S106), Y147 (= Y137), H148 (= H138), E210 (= E198), D244 (= D232), I246 (≠ V234), K273 (= K261), P307 (≠ S296), T308 (≠ S297)
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:420/427 of 4cxqA
- active site: Y18 (≠ F10), Y149 (= Y137), E212 (= E198), D246 (= D232), A249 (≠ M235), K275 (= K261), Y399 (= Y390)
- binding 7-keto-8-aminopelargonic acid: W56 (= W45), Y149 (= Y137), G308 (≠ S295), T310 (≠ S297), R392 (= R383)
- binding pyridoxal-5'-phosphate: G116 (= G105), S117 (= S106), Y149 (= Y137), H150 (= H138), G151 (= G139), E212 (= E198), D246 (= D232), I248 (≠ V234), K275 (= K261), P309 (≠ S296), T310 (≠ S297)
3tfuA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, post-reaction complex with a 3,6- dihydropyrid-2-one heterocycle inhibitor (see paper)
38% identity, 98% coverage: 6:411/415 of query aligns to 15:412/417 of 3tfuA
- active site: Y19 (≠ F10), Y151 (= Y137), E204 (= E198), D238 (= D232), A241 (≠ M235), K267 (= K261), Y391 (= Y390)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-2-oxo-1,2-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: W58 (= W45), G118 (= G105), S119 (= S106), Y151 (= Y137), H152 (= H138), D238 (= D232), I240 (≠ V234), K267 (= K261), P301 (≠ S296), T302 (≠ S297)
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:421/429 of 5kgtA
- active site: Y18 (≠ F10), Y150 (= Y137), E213 (= E198), D247 (= D232), A250 (≠ M235), K276 (= K261), Y400 (= Y390)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (≠ I72), G86 (≠ A74), G309 (≠ S295), T311 (≠ S297)
- binding pyridoxal-5'-phosphate: S116 (= S104), G117 (= G105), S118 (= S106), Y150 (= Y137), H151 (= H138), G152 (= G139), E213 (= E198), D247 (= D232), I249 (≠ V234), K276 (= K261)
5kgsA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2, 3-dihydroinden-1-one (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:421/429 of 5kgsA
- active site: Y18 (≠ F10), Y150 (= Y137), E213 (= E198), D247 (= D232), A250 (≠ M235), K276 (= K261), Y400 (= Y390)
- binding 5-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]-2,3-dihydroinden-1-one: P17 (= P9), Y18 (≠ F10), W57 (= W45), M84 (≠ I72), G86 (≠ A74), Y150 (= Y137), D162 (vs. gap), G165 (vs. gap), G166 (= G148), P310 (≠ S296), T311 (≠ S297), F395 (≠ L385)
- binding pyridoxal-5'-phosphate: G117 (= G105), S118 (= S106), Y150 (= Y137), H151 (= H138), G152 (= G139), E213 (= E198), D247 (= D232), I249 (≠ V234), K276 (= K261)
4xjpA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:421/429 of 4xjpA
- active site: Y18 (≠ F10), Y150 (= Y137), E213 (= E198), D247 (= D232), A250 (≠ M235), K276 (= K261), Y400 (= Y390)
- binding 1-{4-[4-(1,3-benzodioxol-5-ylcarbonyl)piperazin-1-yl]phenyl}ethanone: P17 (= P9), Y18 (≠ F10), W57 (= W45), M84 (≠ I72), G86 (≠ A74), Y150 (= Y137), G165 (vs. gap), G166 (= G148), A219 (= A204), G220 (= G205), G309 (≠ S295), F395 (≠ L385)
- binding pyridoxal-5'-phosphate: G117 (= G105), S118 (= S106), Y150 (= Y137), H151 (= H138), G152 (= G139), E213 (= E198), D247 (= D232), I249 (≠ V234), K276 (= K261), P310 (≠ S296), T311 (≠ S297)
4xjmA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
37% identity, 98% coverage: 6:411/415 of query aligns to 14:421/429 of 4xjmA
- active site: Y18 (≠ F10), Y150 (= Y137), E213 (= E198), D247 (= D232), A250 (≠ M235), K276 (= K261), Y400 (= Y390)
- binding 3-{1-[(5-acetylthiophen-2-yl)carbonyl]piperidin-4-yl}-N-(3-methoxyphenyl)propanamide: P17 (= P9), Y18 (≠ F10), W57 (= W45), M84 (≠ I72), G86 (≠ A74), Y150 (= Y137), M158 (= M145), G165 (vs. gap), G166 (= G148), M167 (≠ A149), W171 (≠ F153), M307 (≠ F293), G309 (≠ S295), T311 (≠ S297)
- binding pyridoxal-5'-phosphate: G117 (= G105), S118 (= S106), Y150 (= Y137), H151 (= H138), G152 (= G139), E213 (= E198), D247 (= D232), I249 (≠ V234), K276 (= K261), P310 (≠ S296), T311 (≠ S297)
4xjlA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound
37% identity, 98% coverage: 6:411/415 of query aligns to 14:421/429 of 4xjlA
- active site: Y18 (≠ F10), Y150 (= Y137), E213 (= E198), D247 (= D232), A250 (≠ M235), K276 (= K261), Y400 (= Y390)
- binding N-(1,2,3-benzothiadiazol-5-yl)-4-phenylpiperazine-1-carboxamide: P17 (= P9), Y18 (≠ F10), W57 (= W45), M84 (≠ I72), G86 (≠ A74), Y150 (= Y137), C161 (vs. gap), G165 (vs. gap), G166 (= G148), A219 (= A204)
- binding pyridoxal-5'-phosphate: G117 (= G105), S118 (= S106), Y150 (= Y137), H151 (= H138), G152 (= G139), E213 (= E198), D247 (= D232), I249 (≠ V234), K276 (= K261), P310 (≠ S296), T311 (≠ S297)
4wygA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis complexed with a fragment hit (see paper)
37% identity, 98% coverage: 6:411/415 of query aligns to 14:421/429 of 4wygA
- active site: Y18 (≠ F10), Y150 (= Y137), E213 (= E198), D247 (= D232), A250 (≠ M235), K276 (= K261), Y400 (= Y390)
- binding 1-{4-[(4-chloro-1H-pyrazol-1-yl)methyl]phenyl}methanamine: Y18 (≠ F10), W57 (= W45), W58 (= W46), Y150 (= Y137), A219 (= A204), F395 (≠ L385)
- binding pyridoxal-5'-phosphate: G117 (= G105), S118 (= S106), Y150 (= Y137), H151 (= H138), E213 (= E198), D247 (= D232), I249 (≠ V234), K276 (= K261), P310 (≠ S296), T311 (≠ S297)
Query Sequence
>Ga0059261_3674 FitnessBrowser__Korea:Ga0059261_3674
MKQSPVWHPFTQHGLNEPVPLVTHAEGAVLHTADGRRVIDAISSWWVTTHGHGNPRIVAA
IRDQAEKLDQLIFAGWTHEPAETVARDLVAMMPRPLDHVFFSDSGSTSVEVAIKMALGHF
ANRGEPRHRIIVMQGSYHGDTIGGMSVGARGVFNRSYAPLLFDVDTIPFPEGANEYRALD
ALEQLCAQSPLPAAMIVEPLVLGAGGMKMYPPGVLRAMREICAAHGVLFIADEVMTGWGR
TGTLLACEQAAVVPDLLCLSKGLTGGSLPLAVTMATPEIFESHRSKDRSKMFFHSSSYTA
NPIACAAAAANLAIWREEPVLERVAHLAHRQRSYSRALAGKVNNLRQLGTIVAMEVQAPQ
GAYLSVLGPRLMSFFRERNVLLRPLGNTVYVMPPYCISDEDLARVYTVIGEALEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory