SitesBLAST
Comparing Ga0059261_3754 FitnessBrowser__Korea:Ga0059261_3754 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
35% identity, 97% coverage: 7:319/322 of query aligns to 8:322/323 of O59791
- S82 (= S77) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
35% identity, 97% coverage: 7:319/322 of query aligns to 3:317/318 of 1wtcA
- active site: K52 (= K52), S77 (= S77), E203 (= E204), G207 (≠ W208), D209 (= D210), G231 (≠ A234), I302 (≠ L304), S303 (= S305)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ P24), K47 (≠ P47), M48 (≠ I48), A109 (≠ D109), A110 (≠ S110), Y114 (≠ L114)
- binding magnesium ion: E203 (= E204), G207 (≠ W208), D209 (= D210)
- binding pyridoxal-5'-phosphate: F51 (= F51), K52 (= K52), N79 (= N79), G178 (= G184), G179 (= G185), G180 (= G186), G181 (≠ L187), G231 (≠ A234), E276 (= E279), T278 (≠ G281), S303 (= S305)
1v71A Crystal structure of s.Pombe serine racemase
35% identity, 97% coverage: 7:319/322 of query aligns to 3:317/318 of 1v71A
- active site: K52 (= K52), S77 (= S77), E203 (= E204), G207 (≠ W208), D209 (= D210), G231 (≠ A234), I302 (≠ L304), S303 (= S305)
- binding magnesium ion: E203 (= E204), G207 (≠ W208), D209 (= D210)
- binding pyridoxal-5'-phosphate: F51 (= F51), K52 (= K52), N79 (= N79), G178 (= G184), G179 (= G185), G180 (= G186), G181 (≠ L187), G231 (≠ A234), E276 (= E279), T278 (≠ G281), S303 (= S305), G304 (= G306)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
35% identity, 97% coverage: 7:319/322 of query aligns to 4:318/319 of 2zr8A
- active site: K53 (= K52), S78 (= S77), E204 (= E204), G208 (≠ W208), D210 (= D210), G232 (≠ A234), I303 (≠ L304), S304 (= S305)
- binding magnesium ion: E204 (= E204), G208 (≠ W208), D210 (= D210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F51), K53 (= K52), S77 (= S76), S78 (= S77), N80 (= N79), H81 (= H80), P147 (= P146), G179 (= G184), G180 (= G185), G181 (= G186), G182 (≠ L187), G232 (≠ A234), E277 (= E279), T279 (≠ G281), S304 (= S305)
- binding serine: S78 (= S77), R129 (= R128), D231 (= D233), G232 (≠ A234), A233 (≠ L235), Q234 (= Q236), T235 (= T237)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
35% identity, 97% coverage: 7:319/322 of query aligns to 4:318/319 of 2zpuA
- active site: K53 (= K52), S78 (= S77), E204 (= E204), G208 (≠ W208), D210 (= D210), G232 (≠ A234), I303 (≠ L304), S304 (= S305)
- binding magnesium ion: E204 (= E204), G208 (≠ W208), D210 (= D210)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F51), K53 (= K52), S77 (= S76), S78 (= S77), N80 (= N79), H81 (= H80), P147 (= P146), G179 (= G184), G180 (= G185), G181 (= G186), G182 (≠ L187), G232 (≠ A234), E277 (= E279), T279 (≠ G281), S304 (= S305)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
40% identity, 94% coverage: 15:318/322 of query aligns to 12:317/319 of A4F2N8
- K53 (= K52) mutation to A: Loss of enzymatic activity.
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
37% identity, 93% coverage: 12:310/322 of query aligns to 24:328/339 of Q7XSN8
- E219 (= E204) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D210) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
5cvcA Structure of maize serine racemase (see paper)
36% identity, 93% coverage: 12:310/322 of query aligns to 8:312/329 of 5cvcA
- active site: K52 (= K52), S77 (= S77), E203 (= E204), A207 (≠ W208), D209 (= D210), G231 (≠ A234), V306 (≠ L304), S307 (= S305)
- binding magnesium ion: E203 (= E204), A207 (≠ W208), D209 (= D210)
- binding pyridoxal-5'-phosphate: F51 (= F51), K52 (= K52), N79 (= N79), S178 (≠ G183), G179 (= G184), G180 (= G185), G181 (= G186), L232 (= L235), E275 (= E279), S307 (= S305), G308 (= G306)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
42% identity, 84% coverage: 42:310/322 of query aligns to 40:305/308 of 1ve5A
- active site: K50 (= K52), S56 (≠ H58), S72 (= S77), E200 (= E204), A204 (≠ W208), D206 (= D210), G229 (≠ A234), L299 (= L304), S300 (= S305)
- binding calcium ion: E200 (= E204), A204 (≠ W208), D206 (= D210)
- binding pyridoxal-5'-phosphate: F49 (= F51), K50 (= K52), N74 (= N79), G175 (= G183), G176 (= G184), G177 (= G185), G178 (= G186), E274 (= E279), T276 (≠ G281), S300 (= S305), G301 (= G306)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:315/320 of 7nbhAAA
- active site: K53 (= K52), S81 (= S77), E207 (= E204), A211 (≠ W208), D213 (= D210), G236 (≠ A234), L309 (= L304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (≠ W208), D213 (= D210)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S77), G85 (≠ A81), Q86 (= Q82), K111 (= K107), I115 (≠ T111), Y118 (≠ L114), D235 (= D233), P281 (= P280), N313 (= N308), V314 (≠ A309), D315 (= D310)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:315/322 of 7nbgAAA
- active site: K53 (= K52), S81 (= S77), E207 (= E204), A211 (≠ W208), D213 (= D210), G236 (≠ A234), L309 (= L304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (≠ W208), D213 (= D210)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (≠ A234), V237 (≠ L235), T282 (≠ G281), S310 (= S305), G311 (= G306)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S77), G85 (≠ A81), Q86 (= Q82), I101 (= I97), K111 (= K107), I115 (≠ T111), Y118 (≠ L114)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:315/323 of 7nbfAAA
- active site: K53 (= K52), S81 (= S77), E207 (= E204), A211 (≠ W208), D213 (= D210), G236 (≠ A234), L309 (= L304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (≠ W208), D213 (= D210)
- binding magnesium ion: N244 (≠ L243)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (≠ A234), V237 (≠ L235), T282 (≠ G281), S310 (= S305), G311 (= G306)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ P24), L22 (≠ P25), T23 (= T26), P24 (= P27), L26 (= L29), T27 (≠ V30), F46 (≠ L45)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:315/323 of 7nbdAAA
- active site: K53 (= K52), S81 (= S77), E207 (= E204), A211 (≠ W208), D213 (= D210), G236 (≠ A234), L309 (= L304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (≠ W208), D213 (= D210)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ A271), L278 (≠ V277), V314 (≠ A309)
- binding magnesium ion: N244 (≠ L243)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (≠ A234), V237 (≠ L235), E280 (= E279), T282 (≠ G281), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:315/323 of 7nbcCCC
- active site: K53 (= K52), S81 (= S77), E207 (= E204), A211 (≠ W208), D213 (= D210), G236 (≠ A234), L309 (= L304), S310 (= S305)
- binding biphenyl-4-ylacetic acid: T78 (≠ A74), H79 (≠ F75), H84 (= H80), V148 (= V144), H149 (≠ P145), P150 (= P146)
- binding calcium ion: E207 (= E204), A211 (≠ W208), D213 (= D210)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (≠ A234), V237 (≠ L235), T282 (≠ G281), S310 (= S305), G311 (= G306)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:315/323 of 7nbcAAA
- active site: K53 (= K52), S81 (= S77), E207 (= E204), A211 (≠ W208), D213 (= D210), G236 (≠ A234), L309 (= L304), S310 (= S305)
- binding calcium ion: E207 (= E204), A211 (≠ W208), D213 (= D210)
- binding magnesium ion: N244 (≠ L243)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N83 (= N79), G182 (= G183), G183 (= G184), G184 (= G185), G185 (= G186), M186 (≠ L187), G236 (≠ A234), V237 (≠ L235), T282 (≠ G281), S310 (= S305), G311 (= G306)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:308/320 of 6zspAAA
- active site: K53 (= K52), S74 (= S77), E200 (= E204), A204 (≠ W208), D206 (= D210), G229 (≠ A234), L302 (= L304), S303 (= S305)
- binding adenosine-5'-triphosphate: S28 (≠ A31), S29 (≠ E32), I30 (= I33), K48 (≠ P47), T49 (≠ I48), Q79 (= Q82), Y111 (≠ L114), E266 (≠ R272), R267 (≠ K273), K269 (≠ R275), N306 (= N308)
- binding magnesium ion: E200 (= E204), A204 (≠ W208), D206 (= D210)
- binding malonate ion: K53 (= K52), S73 (= S76), S74 (= S77), N76 (= N79), H77 (= H80), R125 (= R128), G229 (≠ A234), S232 (≠ T237)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 7:310/310 of 7nbgDDD
- active site: K53 (= K52), S76 (= S77), E202 (= E204), A206 (≠ W208), D208 (= D210), G231 (≠ A234), L304 (= L304), S305 (= S305)
- binding calcium ion: E202 (= E204), A206 (≠ W208), D208 (= D210)
- binding magnesium ion: N239 (≠ L243)
- binding ortho-xylene: S76 (= S77), Q81 (= Q82), I96 (= I97), Y113 (≠ L114)
- binding pyridoxal-5'-phosphate: F52 (= F51), K53 (= K52), N78 (= N79), G177 (= G183), G178 (= G184), G179 (= G185), G180 (= G186), M181 (≠ L187), G231 (≠ A234), V232 (≠ L235), E275 (= E279), T277 (≠ G281), S305 (= S305), G306 (= G306)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
32% identity, 93% coverage: 10:310/322 of query aligns to 8:311/322 of 3l6bA
- active site: K54 (= K52), S77 (= S77), E203 (= E204), A207 (≠ W208), D209 (= D210), G232 (≠ A234), T278 (≠ G281), L305 (= L304), S306 (= S305)
- binding malonate ion: K54 (= K52), S76 (= S76), S77 (= S77), N79 (= N79), H80 (= H80), R128 (= R128), G232 (≠ A234)
- binding manganese (ii) ion: E203 (= E204), A207 (≠ W208), D209 (= D210)
- binding pyridoxal-5'-phosphate: F53 (= F51), K54 (= K52), N79 (= N79), G178 (= G183), G179 (= G184), G180 (= G185), G181 (= G186), M182 (≠ L187), V233 (≠ L235), E276 (= E279), T278 (≠ G281), S306 (= S305), G307 (= G306)
1ve5D Crystal structure of t.Th. Hb8 threonine deaminase
39% identity, 84% coverage: 42:310/322 of query aligns to 40:277/280 of 1ve5D
- active site: K50 (= K52), S56 (≠ H58), S72 (= S77), E172 (= E204), A176 (≠ W208), D178 (= D210), G201 (≠ A234), L271 (= L304), S272 (= S305)
- binding calcium ion: E172 (= E204), A176 (≠ W208), D178 (= D210)
- binding pyridoxal-5'-phosphate: F49 (= F51), K50 (= K52), N74 (= N79), G147 (= G183), G148 (= G184), G149 (= G185), G150 (= G186), V202 (≠ L235), E246 (= E279), T248 (≠ G281), S272 (= S305), G273 (= G306)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
34% identity, 89% coverage: 23:310/322 of query aligns to 28:314/326 of 2gn2A
- active site: K56 (= K52), A81 (≠ S77), Q207 (≠ E204), V211 (≠ W208), G213 (≠ D210), G235 (≠ A234), I308 (≠ L304), S309 (= S305)
- binding cytidine-5'-monophosphate: R51 (≠ P47), T52 (≠ I48), G53 (= G49), A114 (≠ S110), D117 (≠ A113), Y118 (≠ L114), N312 (= N308)
Query Sequence
>Ga0059261_3754 FitnessBrowser__Korea:Ga0059261_3754
VTILRQPTRAGVRDAAAKVAAILPPTPLLVAEIRGIPVMFKAECLQPIGAFKIRGAWHRL
TAIDPEQREKGVVAFSSGNHAQGVAWAAKRLGIPAVIVMPADAPAAKRDSTLALGAEVVA
YDRMKEDRVKIAAHLAHARGATLVPPFDDPWIIEGQGSMAIEVLTQAAEMRLPDPGRIVV
PCGGGGLASGVTLALPEAQTTIVEPEGWDDMCRSLANGWIESIGESPPPTACDALQTFQP
AQLTFDVLSRRGATGVAVSEAEVRAAQRWAARKLRLVVEPGGAVALAALLAGKVDPTPDT
LVILSGGNADPDAYARVLASSD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory