Comparing Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
46% identity, 88% coverage: 13:226/243 of query aligns to 10:223/233 of P75957
7mdyC Lolcde nucleotide-bound
46% identity, 88% coverage: 13:226/243 of query aligns to 7:220/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
46% identity, 88% coverage: 13:226/243 of query aligns to 7:220/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
45% identity, 88% coverage: 13:226/243 of query aligns to 9:222/229 of 7v8iD
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
39% identity, 93% coverage: 7:233/243 of query aligns to 3:227/650 of 5ws4A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
37% identity, 91% coverage: 9:229/243 of query aligns to 5:224/648 of P75831
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
36% identity, 95% coverage: 9:240/243 of query aligns to 4:235/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
36% identity, 95% coverage: 9:240/243 of query aligns to 4:235/615 of 5lilA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 92% coverage: 9:231/243 of query aligns to 2:228/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 92% coverage: 9:231/243 of query aligns to 2:228/230 of 1l2tA
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
39% identity, 92% coverage: 7:230/243 of query aligns to 2:221/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
39% identity, 92% coverage: 7:230/243 of query aligns to 2:221/229 of 6z67B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
42% identity, 83% coverage: 26:227/243 of query aligns to 17:217/223 of 2pclA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 91% coverage: 9:229/243 of query aligns to 4:223/226 of 5xu1B
8g4cB Bceabs atpgs high res tm (see paper)
33% identity, 90% coverage: 9:226/243 of query aligns to 4:221/248 of 8g4cB
7tchB Bceab e169q variant atp-bound conformation (see paper)
33% identity, 90% coverage: 9:226/243 of query aligns to 3:220/245 of 7tchB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
40% identity, 86% coverage: 26:233/243 of query aligns to 15:221/240 of 4ymuJ
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
42% identity, 81% coverage: 32:228/243 of query aligns to 28:217/218 of 7w78A
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
43% identity, 81% coverage: 32:227/243 of query aligns to 28:216/216 of 7w79A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
40% identity, 86% coverage: 26:233/243 of query aligns to 16:221/241 of 4u00A
Sites not aligning to the query:
>Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component
MMIKADAAIDAREVSKSYTVGQVRTQILFGVSVSVMPGELTLVVGPSGCGKSTLLAILSG
LTLPDQGEVDALGNPICRMKAGARDAFRLANTGFVFQGFNLFNALTAEEQVAYVLQCMKV
KPAEARQRARAALEAVGLGPRMRLRPFELSGGEKQRVAIARALAKQPRILFADEPTSALD
SHNGHAVIALLRDIAHNQGAAVLCVTHDPRLLSFADRIIHMEDGRIIRDERPDPTSAVQR
ETH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory