Comparing Ga0059261_3889 FitnessBrowser__Korea:Ga0059261_3889 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2x41A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with glucose (see paper)
32% identity, 94% coverage: 38:741/748 of query aligns to 2:705/715 of 2x41A
2x42A Structure of beta-glucosidase 3b from thermotoga neapolitana in complex with alpha-d-glucose (see paper)
32% identity, 94% coverage: 38:741/748 of query aligns to 2:705/715 of 2x42A
5wabA Crystal structure of bifidobacterium adolescentis gh3 beta-glucosidase (see paper)
31% identity, 94% coverage: 43:742/748 of query aligns to 5:646/674 of 5wabA
4i8dB Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
31% identity, 95% coverage: 38:744/748 of query aligns to 16:714/714 of 4i8dB
4i8dA Crystal structure of beta-d-glucoside glucohydrolase from trichoderma reesei (see paper)
31% identity, 95% coverage: 38:744/748 of query aligns to 13:711/711 of 4i8dA
7zgzX Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside hydrolysed to xylose
28% identity, 93% coverage: 37:732/748 of query aligns to 13:721/753 of 7zgzX
7zb3A Crystal structure of beta-xylosidase from thermotoga maritima in complex with xylohexaose hydrolysed to xylobiose
28% identity, 93% coverage: 37:732/748 of query aligns to 13:732/765 of 7zb3A
7zdyW Crystal structure of beta-xylosidase from thermotoga maritima in complex with methyl-beta-d-xylopyranoside
28% identity, 93% coverage: 37:732/748 of query aligns to 13:732/763 of 7zdyW
4i3gB Crystal structure of desr, a beta-glucosidase from streptomyces venezuelae in complex with d-glucose. (see paper)
41% identity, 49% coverage: 38:405/748 of query aligns to 4:365/780 of 4i3gB
Sites not aligning to the query:
4iihA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with thiocellobiose (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/833 of 4iihA
Sites not aligning to the query:
4iicA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with isofagomine (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/833 of 4iicA
Sites not aligning to the query:
4iigA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with d-glucose (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/834 of 4iigA
Sites not aligning to the query:
4iieA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with calystegine b(2) (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/834 of 4iieA
Sites not aligning to the query:
4iidA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with 1-deoxynojirimycin (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/834 of 4iidA
Sites not aligning to the query:
4iibA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/834 of 4iibA
Sites not aligning to the query:
4iifA Crystal structure of beta-glucosidase 1 from aspergillus aculeatus in complex with castanospermine (see paper)
30% identity, 81% coverage: 34:636/748 of query aligns to 21:638/833 of 4iifA
Sites not aligning to the query:
6jxgA Crystasl structure of beta-glucosidase d2-bgl from chaetomella raphigera (see paper)
31% identity, 89% coverage: 73:741/748 of query aligns to 38:710/713 of 6jxgA
5z87A Structural of a novel b-glucosidase emgh1 at 2.3 angstrom from erythrobacter marinus
31% identity, 80% coverage: 108:702/748 of query aligns to 109:718/756 of 5z87A
5ju6A Structural and functional studies of glycoside hydrolase family 3 beta-glucosidase cel3a from the moderately thermophilic fungus rasamsonia emersonii (see paper)
31% identity, 81% coverage: 34:641/748 of query aligns to 22:639/835 of 5ju6A
Sites not aligning to the query:
5fjiA Three-dimensional structures of two heavily n-glycosylated aspergillus sp. Family gh3 beta-d-glucosidases (see paper)
29% identity, 81% coverage: 34:641/748 of query aligns to 22:645/840 of 5fjiA
Sites not aligning to the query:
>Ga0059261_3889 FitnessBrowser__Korea:Ga0059261_3889
MSRTIAALLTASALAAFTATQGVAQQAPVPAATDARVRAESIVARMTLDEKIALVHGLFP
PLTKVKPVNELVPSAGHIEGNPRLGVPLVRESDASLGVANQVEQRKGDVATALPSSLATA
ATFDPEIARAGGAMIGAEARAKRFNVLLAGGVNLNRDPWGGRNFEYLGEDPLLAGELAGA
HIAGVQSNRIVSTIKHFALNSQETGRMVLDARIGEAALRESDLLAFQIAIEKGKPASVMC
AYNKVNGDWACENDFLLNQVLKRDWGFSGWVMSDWGGVHSTEKAAKAGLDQQSGQELDRA
MYFDAPLKEAVENGRVPMARLDDMVVRYLTGLIESGAYDTPMPATAQTPDYAANALVAQR
AAEAGIVLLKNQGGILPLAATAKKIVVIGGGADVGVLSGGGSSQVRSVGGAPIEIPLAHG
PAASFVRVTYHASSPLEALRKALPGAQVRFVDGRNLNATVDAAKAADLAIVFATQWTTEA
EDVPDLRLQNHQDALIAAVAAAQPKTVAVLTTGGPVTMPWLDRVPAVVQAWYPGQRGGEA
IANILTGKVNPSGRLPITFPAHEGQAPRPQPVGLDTFTALQAAAAANPANPGGYELKSFP
VDYVEGSDVGYRWYEKQGHKPLFAFGHGLSYTSFAYGKAAVTGGKRLTVAFDVTNTGKRA
GADVPQVYVTREGSNIPMRLAAFKRIELQPGETRRVTLTAEPRILADYDTSLPGWRIRGG
TYRIAIARDATDRSMLLTTSLDPATMKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory