SitesBLAST
Comparing Ga0059261_3963 FitnessBrowser__Korea:Ga0059261_3963 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P21310 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 4 papers)
55% identity, 99% coverage: 2:493/497 of query aligns to 6:503/510 of P21310
- S144 (= S139) modified: 2,3-didehydroalanine (Ser); mutation S->A,T: Complete loss of activity.; mutation to C: No effect.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1gkmA Histidine ammonia-lyase (hal) from pseudomonas putida inhibited with l-cysteine (see paper)
55% identity, 99% coverage: 2:493/497 of query aligns to 5:500/507 of 1gkmA
- active site: Y53 (= Y49), G60 (= G56), H83 (= H79), N193 (= N186), Y278 (= Y271), R281 (= R274), F327 (= F320), E412 (= E405)
- binding cysteine: G142 (= G140), L189 (= L182), N193 (= N186), F327 (= F320)
P21213 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Rattus norvegicus (Rat) (see paper)
45% identity, 91% coverage: 30:483/497 of query aligns to 145:607/657 of P21213
- S254 (= S139) mutation to A: Complete loss of activity.
Q20502 Histidine ammonia-lyase; Histidase; EC 4.3.1.3 from Caenorhabditis elegans (see paper)
43% identity, 97% coverage: 17:496/497 of query aligns to 147:640/677 of Q20502
- D536 (= D396) mutation to N: In am130; causes strong resistance to nickel and zinc toxicity.
Q0VZ68 Tyrosine 2,3-aminomutase; Tyrosine ammonia-lyase; EC 5.4.3.6; EC 4.3.1.23 from Chondromyces crocatus (see paper)
37% identity, 93% coverage: 23:485/497 of query aligns to 25:511/531 of Q0VZ68
- F57 (= F55) mutation to Y: Loss of aminomutase activity.
- LVPVMI 60:65 (≠ LASVRI 58:63) mutation to MIYMLV: Shift towards ammonia lyase activity.
- RSHA 79:82 (≠ LSHA 77:80) mutation to TFLS: Total loss of aminomutase activity.
- RSHAA 79:83 (≠ LSHAA 77:81) mutation to YHLAT: Total loss of aminomutase activity.
- G184 (= G177) mutation to R: Gain of aminomutase activity.
- K242 (≠ R235) mutation to R: Gain of aminomutase activity.
- 275:288 (vs. 263:267, 14% identical) mutation Missing: Total loss of aminomutase activity.
- P377 (= P353) mutation to R: No effect.
- C396 (≠ S370) mutation to S: No effect.
- E399 (≠ M373) mutation to A: Loss of aminomutase activity and increased product racemization. Gain of ammonia-lyase activity.; mutation to K: Loss of aminomutase and ammonia-lyase activity. Higher enantiomeric excess of (R)-beta-tyrosine.; mutation to M: Loss of aminomutase and ammonia-lyase activity.
- 399:406 (vs. 373:380, 25% identical) mutation to MIAQVTSA: Residual aminomutase activity.
- 427:433 (vs. 401:407, 14% identical) mutation to SAGREDH: Total loss of aminomutase activity.; mutation to SANQEDH: Total loss of aminomutase activity.
Q8GMG0 MIO-dependent tyrosine 2,3-aminomutase; Tyrosine ammonia-lyase; EC 5.4.3.6; EC 4.3.1.23 from Streptomyces globisporus (see 3 papers)
40% identity, 92% coverage: 30:488/497 of query aligns to 44:527/539 of Q8GMG0
- Y63 (= Y49) active site, Proton donor/acceptor; mutation to F: Complete loss of activity. It does not affect the over-all structure of the enzyme.
- E71 (≠ K57) mutation to A: Despite a decrease in activity, it shows lyase activity over time and still produced some amount of beta-tyrosine.
- H93 (= H79) binding ; mutation to F: Complete loss of activity.
- A152 (= A138) modified: Crosslink with 154, 5-imidazolinone (Ala-Gly)
- S153 (= S139) modified: 2,3-didehydroalanine (Ser)
- G154 (= G140) modified: Crosslink with 152, 5-imidazolinone (Ala-Gly)
- N205 (= N186) binding
- Y303 (vs. gap) mutation to A: Despite a decrease in activity, it shows lyase activity over time and still produced some amount of beta-tyrosine.
- R311 (= R274) binding
- Y415 (≠ V377) mutation to V: Complete loss of activity.
2rjsA Sgtam bound to substrate mimic (see paper)
40% identity, 92% coverage: 30:488/497 of query aligns to 33:514/526 of 2rjsA
- active site: Y52 (= Y49), G59 (= G56), H82 (= H79), N192 (= N186), Y295 (= Y271), R298 (= R274), F343 (= F320), Q429 (≠ E405)
- binding (3R)-3-amino-2,2-difluoro-3-(4-methoxyphenyl)propanoic acid: Y52 (= Y49), G59 (= G56), H82 (= H79), G141 (= G140), L143 (= L142), N192 (= N186), Y295 (= Y271), R298 (= R274), F343 (= F320), Q429 (≠ E405)
2rjrA Substrate mimic bound to sgtam (see paper)
40% identity, 92% coverage: 30:488/497 of query aligns to 33:514/526 of 2rjrA
- active site: Y52 (= Y49), G59 (= G56), H82 (= H79), N192 (= N186), Y295 (= Y271), R298 (= R274), F343 (= F320), Q429 (≠ E405)
- binding (2S,3S)-3-(4-fluorophenyl)-2,3-dihydroxypropanoic acid: Y52 (= Y49), G59 (= G56), H82 (= H79), G141 (= G140), L143 (= L142), N192 (= N186), F343 (= F320), Q429 (≠ E405)
2qveA Crystal structure of sgtam bound to mechanism based inhibitor (see paper)
40% identity, 92% coverage: 30:488/497 of query aligns to 33:514/526 of 2qveA
- active site: Y52 (= Y49), G59 (= G56), H82 (= H79), N192 (= N186), Y295 (= Y271), R298 (= R274), F343 (= F320), Q429 (≠ E405)
- binding (3R)-3-amino-2,2-difluoro-3-(4-hydroxyphenyl)propanoic acid: Y52 (= Y49), G59 (= G56), H82 (= H79), G141 (= G140), L143 (= L142), N192 (= N186), Y295 (= Y271), R298 (= R274), F343 (= F320), Q429 (≠ E405)
3kdzA X-ray crystal structure of a tyrosine aminomutase mutant construct with bound ligand (see paper)
40% identity, 92% coverage: 30:488/497 of query aligns to 34:515/527 of 3kdzA
- active site: F53 (≠ Y49), G60 (= G56), H83 (= H79), N193 (= N186), Y296 (= Y271), R299 (= R274), F344 (= F320), Q430 (≠ E405)
- binding tyrosine: F53 (≠ Y49), Y59 (≠ F55), G60 (= G56), H83 (= H79), G142 (= G140), N193 (= N186), Y296 (= Y271), R299 (= R274), F344 (= F320)
2o7dA Tyrosine ammonia-lyase from rhodobacter sphaeroides, complexed with caffeate (see paper)
39% identity, 92% coverage: 23:478/497 of query aligns to 28:504/515 of 2o7dA
- active site: Y54 (= Y49), G61 (= G56), L84 (≠ H79), N195 (= N186), Y292 (= Y271), R295 (= R274), F342 (= F320), Q428 (≠ E405)
- binding caffeic acid: G61 (= G56), H83 (≠ S78), L84 (≠ H79), Y292 (= Y271), R295 (= R274), N424 (≠ S401), N427 (≠ Q404), Q428 (≠ E405)
2o7eA Tyrosine ammonia-lyase from rhodobacter sphaeroides (his89phe variant), bound to 2-aminoindan-2-phosphonic acid (see paper)
39% identity, 92% coverage: 23:478/497 of query aligns to 28:504/515 of 2o7eA
- active site: Y54 (= Y49), G61 (= G56), L84 (≠ H79), N195 (= N186), Y292 (= Y271), R295 (= R274), F342 (= F320), Q428 (≠ E405)
- binding (2-amino-2,3-dihydro-1h-inden-2-yl)phosphonic acid: Y54 (= Y49), G143 (= G140), L145 (= L142), N195 (= N186), Y292 (= Y271), R295 (= R274), N325 (= N304), F342 (= F320)
3unvA Pantoea agglomerans phenylalanine aminomutase (see paper)
31% identity, 89% coverage: 29:470/497 of query aligns to 33:494/514 of 3unvA
- active site: Y53 (= Y49), G60 (= G56), V83 (≠ H79), L191 (= L184), D291 (= D269), S294 (≠ C272), G340 (= G318), D427 (≠ N403)
- binding phenylalanine: Y53 (= Y49), G60 (= G56), G142 (= G140), L144 (= L142), N326 (= N304), F342 (= F320)
- binding (3S)-3-amino-3-phenylpropanoic acid: Y53 (= Y49), G60 (= G56), G142 (= G140), N193 (= N186), N326 (= N304), F342 (= F320)
6s7qA Crystal structure of ergothioneine degrading enzyme ergothionase from treponema denticola in complex with desmethyl-ergothioneine sulfonic acid (see paper)
28% identity, 97% coverage: 8:488/497 of query aligns to 9:494/497 of 6s7qA
- active site: Y53 (= Y49), G60 (= G56), D275 (= D269), A324 (≠ G318)
- binding (2~{S})-2-(dimethylamino)-3-(2-sulfo-1~{H}-imidazol-4-yl)propanoic acid: Y53 (= Y49), V59 (≠ F55), G60 (= G56), S194 (≠ N186), F326 (= F320), T380 (≠ I374), K383 (≠ V377), E411 (= E405)
Q3M5Z3 Phenylalanine ammonia-lyase; EC 4.3.1.24 from Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) (see 2 papers)
37% identity, 66% coverage: 31:359/497 of query aligns to 60:403/567 of Q3M5Z3
- L108 (≠ H79) mutation to A: Slightly decreases catalytic rate.; mutation to G: Decreases catalytic rate.
- A167 (= A138) modified: Crosslink with 169, 5-imidazolinone (Ala-Gly)
- S168 (= S139) modified: 2,3-didehydroalanine (Ser)
- G169 (= G140) modified: Crosslink with 167, 5-imidazolinone (Ala-Gly)
Sites not aligning to the query:
- 1:21 mutation Missing: No effect on enzyme activity.
- 503 C→S: Prevents formation of artifactual disulfide bonds and increases solubility; when associated with S-565.
- 565 C→S: Prevents formation of artifactual disulfide bonds and increases solubility; when associated with S-503.
5ltmB Crystal structure of phenylalanine ammonia-lyase from anabaena variabilis (y78f-c503s-c565s) bound to cinnamate (see paper)
32% identity, 83% coverage: 31:442/497 of query aligns to 36:463/537 of 5ltmB
- active site: F54 (≠ Y49), G61 (= G56), L84 (≠ H79), N197 (= N186), Y288 (= Y271), R291 (= R274), F337 (= F320), Q426 (≠ D406)
- binding hydrocinnamic acid: F60 (= F55), A143 (= A138), L145 (= L142), Y288 (= Y271), R291 (= R274)
B2J528 Phenylalanine ammonia-lyase; EC 4.3.1.24 from Nostoc punctiforme (strain ATCC 29133 / PCC 73102) (see paper)
30% identity, 83% coverage: 31:442/497 of query aligns to 60:489/569 of B2J528
- A167 (= A138) modified: Crosslink with 169, 5-imidazolinone (Ala-Gly)
- S168 (= S139) modified: 2,3-didehydroalanine (Ser)
- G169 (= G140) modified: Crosslink with 167, 5-imidazolinone (Ala-Gly)
P11544 Phenylalanine/tyrosine ammonia-lyase; Bifunctional phenylalanine ammonia-lyase; Bifunctional PAL; EC 4.3.1.25 from Rhodotorula toruloides (Yeast) (Rhodosporidium toruloides) (see paper)
33% identity, 84% coverage: 27:444/497 of query aligns to 90:539/716 of P11544
- A211 (= A138) modified: Crosslink with 213, 5-imidazolinone (Ala-Gly)
- S212 (= S139) modified: 2,3-didehydroalanine (Ser)
- G213 (= G140) modified: Crosslink with 211, 5-imidazolinone (Ala-Gly)
- K468 (≠ M373) binding
- E496 (≠ S401) binding
Q68G84 Phenylalanine aminomutase (L-beta-phenylalanine forming); Phenylalanine ammonia-lyase; EC 5.4.3.10; EC 4.3.1.24 from Taxus chinensis (Chinese yew) (Taxus wallichiana var. chinensis) (see 2 papers)
30% identity, 93% coverage: 27:487/497 of query aligns to 58:535/687 of Q68G84
- Y80 (= Y49) active site, Proton donor/acceptor; mutation Y->A,F: Abolishes enzyme activity.
- A175 (= A138) modified: Crosslink with 177, 5-imidazolinone (Ala-Gly)
- S176 (= S139) modified: 2,3-didehydroalanine (Ser)
- G177 (= G140) modified: Crosslink with 175, 5-imidazolinone (Ala-Gly)
- N231 (= N186) binding ; mutation to A: Abolishes the formation of the MIO cofactor and thereby abolishes enzyme activity.; mutation to X: Abolishes enzyme activity; when associated with X-355.
- Q319 (= Q268) binding ; mutation to M: Increases deamination activity with beta-Phe. Increases beta-regioselectivity in the amination of cinnamate. Abolishes enzyme activity; when associated with K-325.
- Y322 (= Y271) mutation to A: Abolishes the formation of the MIO cofactor and thereby abolishes enzyme activity.; mutation to X: Abolishes enzyme activity; when associated with X-371.
- R325 (= R274) binding ; mutation to K: Increases deamination activity with beta-Phe. Increases beta-regioselectivity in the amination of cinnamate. Abolishes enzyme activity; when associated with M-319.
- N355 (= N304) binding ; mutation to X: Abolishes enzyme activity; when associated with X-231.
- F371 (= F320) mutation to X: Abolishes enzyme activity; when associated with X-322.
- N458 (≠ Q404) binding
Q6GZ04 Phenylalanine aminomutase (L-beta-phenylalanine forming); Phenylalanine ammonia-lyase; EC 5.4.3.10; EC 4.3.1.24 from Taxus canadensis (Canadian yew) (see paper)
30% identity, 93% coverage: 27:487/497 of query aligns to 58:535/698 of Q6GZ04
- Y80 (= Y49) mutation to F: Abolishes enzyme activity.
- L104 (≠ I75) mutation to A: Decreases enzyme activity.
- Q319 (= Q268) binding
- R325 (= R274) binding
Query Sequence
>Ga0059261_3963 FitnessBrowser__Korea:Ga0059261_3963
MITPGYTPLSTWNAIYRGEAAPLDPSCRDKIQASADAVEAILARHEPVYGINTGFGKLAS
VRIGDEDLETLQRNIVLSHAAGVGAPMPAPVVRLMIALKLASLAQGHSGVRPATIAMLQD
MLDRGITPIIPSQGSVGASGDLAPLAHLAAAMIGTGEVLVDGVVRPARDVLAPLTLGPKE
GLALLNGTQFSTAYALAALFETERLFRAALVTGALSTEAAKGSDTPFDPRIHQVRGHRGQ
IEVADALAGLMSGSAIRASHREGDERVQDPYCLRCQPQVMGACLDLIRQAAATLAIEANG
VTDNPLIFPDTGEALSGGNFHAEPVAFAADMLAMALCEIGSLSERRIAMLVDPALSGLPA
FLTPRPGLNSGFMIPQVTAAALVSENKQRAHPASVDSIPTSANQEDHVSMAGHGARRLME
MAANLANVLGIEYLAAAQGCDFHAPLTSSEPLEAARSLLRNQVPHLEDDRHFAPDMAAAT
ALVAGGMLGPYLPGIER
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory