Comparing Ga0059261_3995 FitnessBrowser__Korea:Ga0059261_3995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P76216 N-succinylarginine dihydrolase; EC 3.5.3.23 from Escherichia coli (strain K12) (see paper)
44% identity, 98% coverage: 5:412/418 of query aligns to 5:433/447 of P76216
1ynhB Crystal structure of n-succinylarginine dihydrolase, astb, bound to substrate and product, an enzyme from the arginine catabolic pathway of escherichia coli (see paper)
44% identity, 98% coverage: 5:412/418 of query aligns to 4:432/440 of 1ynhB
1yniA Crystal structure of n-succinylarginine dihydrolase, astb, bound to substrate and product, an enzyme from the arginine catabolic pathway of escherichia coli (see paper)
43% identity, 98% coverage: 5:412/418 of query aligns to 4:432/440 of 1yniA
>Ga0059261_3995 FitnessBrowser__Korea:Ga0059261_3995
MPRVEINFDGLIGPSHNYAGLSPGNLAATRNSGAVSQPRAAALQGIAKMRANLALGLTQG
ILLPHARPDHRWLDSLATSYTDAAAHLQAQALSASSMWAANAATVSPAPDTADGRCHLTV
ANLVTMPHRSHEWPGTLAQLRLAFGNDAFRVHGPVPAPFGDEGAANHMRLCPEHDAPGVE
VFVYGVSGGPFPARQHREASEAVARRHGLDPARTLFVQQSEAAIAAGAFHNDVVAVANGR
VLFAHEQAFADKQGFYADLRRVMPEVEIVEVPASAVSLADAISSYLFNAQLVTLPSGETA
LVLPTEARDTPSVWAWLQAHVAGNGPIRHLEVVDVRQSMANGGGPACLRLRVVADPATID
PRFLVDPGKLDRIAALVEMHWPETIAQDEIGDPALIARIEAARAALLDLLGIVELIDS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory