SitesBLAST
Comparing Ga0059261_4061 FitnessBrowser__Korea:Ga0059261_4061 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
36% identity, 95% coverage: 10:286/291 of query aligns to 6:288/295 of 1xc3A
3lm9A Crystal structure of fructokinase with adp and fructose bound in the active site (see paper)
36% identity, 95% coverage: 10:286/291 of query aligns to 6:288/294 of 3lm9A
- binding adenosine-5'-diphosphate: G130 (= G133), T131 (= T134), G182 (= G185), P183 (= P186), E186 (≠ Q189), A193 (≠ L196), G231 (= G232)
- binding beta-D-fructofuranose: G60 (= G63), D104 (= D107), I133 (= I136), E151 (= E154), E177 (= E180)
- binding zinc ion: H154 (= H157), C169 (= C172), H172 (= H175), C175 (= C178)
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
26% identity, 55% coverage: 75:233/291 of query aligns to 152:334/396 of 1z05A
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
33% identity, 66% coverage: 8:199/291 of query aligns to 6:201/308 of 2yi1A
- binding adenosine-5'-diphosphate: G11 (= G13), T13 (= T15), N14 (≠ K16), R16 (≠ L18), T140 (= T134), G189 (= G185)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: G12 (= G14), G71 (≠ F62), G72 (= G63), R73 (≠ P64), S84 (≠ T80), T85 (≠ P81), L87 (vs. gap), N112 (≠ T106), D113 (= D107), G139 (= G133), T140 (= T134), G141 (= G135), I142 (= I136), E162 (= E154), H165 (= H157), E184 (= E180)
- binding calcium ion: N112 (≠ T106), N115 (= N109), G144 (≠ A138), A161 (≠ P153)
- binding zinc ion: H165 (= H157), C175 (≠ S170), C177 (= C172), C182 (= C178)
Sites not aligning to the query:
2yhyA Structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp (see paper)
33% identity, 66% coverage: 8:199/291 of query aligns to 6:201/308 of 2yhyA
- binding adenosine-5'-diphosphate: G11 (= G13), G12 (= G14), T13 (= T15), N14 (≠ K16), R16 (≠ L18), T140 (= T134), G189 (= G185)
- binding calcium ion: N112 (≠ T106), N115 (= N109), G144 (≠ A138), A161 (≠ P153)
- binding zinc ion: H165 (= H157), C175 (≠ S170), C177 (= C172), C182 (= C178)
Sites not aligning to the query:
Q9Y223 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Homo sapiens (Human) (see 18 papers)
33% identity, 66% coverage: 8:200/291 of query aligns to 410:606/722 of Q9Y223
- D413 (≠ E11) binding
- G416 (= G14) binding
- T417 (= T15) binding
- N418 (≠ K16) binding
- R420 (≠ L18) binding
- I472 (= I59) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 50% of the wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity
- G476 (= G63) binding ; binding
- R477 (≠ P64) binding ; binding
- T489 (≠ P81) binding ; binding
- N516 (≠ T106) binding ; binding
- D517 (= D107) active site; binding ; binding ; mutation D->A,N: Loss of N-acylmannosamine kinase activity. Decreased affinity for N-acyl-D-mannosamine. No effect on structure.
- N519 (= N109) to S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs1554658910; mutation to S: Decreased N-acylmannosamine kinase activity.
- A524 (= A114) to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs764698870
- F528 (≠ A118) to C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; dbSNP:rs986773986; mutation to C: Decreased N-acylmannosamine kinase activity.
- G545 (= G135) binding
- E566 (= E154) binding
- H569 (= H157) binding ; binding ; binding
- V572 (= V160) to L: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70-80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity; does not affect homohexamers formation; dbSNP:rs121908632
- G576 (≠ P167) to E: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs121908625
- C579 (≠ S170) binding
- C581 (= C172) binding
- C586 (= C178) binding
- I587 (≠ A179) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs748949603; mutation to T: Decreased N-acylmannosamine kinase activity.
- E588 (= E180) binding ; binding
Sites not aligning to the query:
- 13 C → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; dbSNP:rs1209266607
- 19 binding
- 23 binding
- 113 binding
- 132 H → Q: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; impaired homohexamers formation
- 176 D → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs139425890
- 177 R → C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs539332585
- 200 I → F: in NM; uncertain significance; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 90% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs369328625
- 206 G → S: in NM; moderate phenotype with unusual involvement of quadriceps; dbSNP:rs766266918
- 220 binding
- 253 binding
- 259 binding
- 263 R → L: in SIALURIA; strong reduction of feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908623
- 266 R → Q: in SIALURIA; abolishes feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908622; R → W: in sialuria; dbSNP:rs121908621
- 271 binding
- 280 binding
- 281 binding
- 282 binding
- 301 binding
- 302 binding
- 303 C → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to 60% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs121908633
- 307 binding
- 321 binding
- 331 V → A: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation
- 378 D → Y: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 10-30% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs199877522
- 630 A → T: in NM; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs1382191649
- 631 A → T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs121908626; A → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs62541771; mutation A->V,T: Decreased N-acylmannosamine kinase activity.
- 708 G → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; severely decreased; dbSNP:rs1554657922
- 712 M→T: Decreased N-acylmannosamine kinase activity.
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 79% coverage: 7:235/291 of query aligns to 4:260/304 of 7p9pAAA
- binding phosphoaminophosphonic acid-adenylate ester: G11 (= G14), T12 (= T15), K13 (= K16), G133 (= G133), T134 (= T134), G194 (= G185), E198 (≠ Q189), A211 (= A202), G256 (= G231), G257 (= G232), N260 (≠ D235)
- binding zinc ion: H159 (= H157), C180 (≠ S170), C182 (= C172), C187 (= C178), E213 (≠ A205), H217 (≠ D209)
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
27% identity, 79% coverage: 7:235/291 of query aligns to 3:259/303 of 7p9lAAA
- binding 2-acetamido-2-deoxy-6-O-phosphono-beta-D-glucopyranose: P66 (= P64), G67 (≠ V65), S79 (≠ T80), N105 (≠ T106), D106 (= D107), G132 (= G133), T133 (= T134), G134 (= G135), V135 (≠ I136), G136 (= G137), E155 (= E154), H158 (= H157), D188 (≠ E180)
- binding zinc ion: H158 (= H157), C179 (≠ S170), C181 (= C172), C186 (= C178), E212 (≠ A205), H216 (≠ D209)
O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
33% identity, 66% coverage: 8:200/291 of query aligns to 410:606/722 of O35826
- D413 (≠ E11) mutation D->K,N: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
- R420 (≠ L18) mutation to M: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
Sites not aligning to the query:
- 1 UDP-N-acetylglucosamine 2-epimerase
- 49 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Does not interfere with enzyme oligomerization.
- 110 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 132 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 155 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 157 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 406:722 N-acetylmannosamine kinase
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 79% coverage: 7:236/291 of query aligns to 6:263/306 of 7p7wBBB
2qm1B Crystal structure of glucokinase from enterococcus faecalis
25% identity, 79% coverage: 5:233/291 of query aligns to 6:272/325 of 2qm1B
2yhwA High-resolution crystal structures of n-acetylmannosamine kinase: insights about substrate specificity, activity and inhibitor modelling. (see paper)
34% identity, 66% coverage: 8:199/291 of query aligns to 6:201/309 of 2yhwA
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
34% identity, 63% coverage: 8:190/291 of query aligns to 4:185/312 of 3vglA
- binding phosphoaminophosphonic acid-adenylate ester: G9 (= G13), T11 (= T15), K12 (= K16), G130 (≠ A128), T131 (≠ Y129), G180 (= G185)
- binding beta-D-glucopyranose: G65 (= G63), P78 (= P81), N103 (≠ T106), D104 (= D107), L133 (≠ T131), G134 (≠ V132), E153 (= E154), H156 (= H157), E175 (= E180)
- binding zinc ion: H156 (= H157), C166 (= C172), C168 (≠ F174), C173 (= C178)
Sites not aligning to the query:
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
34% identity, 63% coverage: 8:190/291 of query aligns to 4:185/312 of 3vgkB
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
25% identity, 70% coverage: 27:231/291 of query aligns to 24:252/306 of 5f7rA
- binding alpha-D-glucopyranose: G70 (= G63), N110 (≠ D107), N110 (≠ D107), S134 (≠ T131), V135 (= V132), G138 (= G135), L139 (≠ I136), G140 (= G137), E159 (= E154), H162 (= H157), E181 (= E180)
- binding zinc ion: H162 (= H157), C172 (= C172), C174 (≠ F174), C179 (= C178)
Sites not aligning to the query:
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
28% identity, 72% coverage: 77:285/291 of query aligns to 82:298/309 of P32718
- F145 (≠ A138) mutation to L: 10-fold increase in catalytic efficiency for glucose phosphorylation. Slight increase in catalytic efficiency for D-allose phosphorylation.
Sites not aligning to the query:
- 73 A→G: 60-fold increase in catalytic efficiency for glucose phosphorylation. 45-fold increase in D-glucose affinity. No change in catalytic efficiency for D-allose phosphorylation.
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
31% identity, 48% coverage: 93:231/291 of query aligns to 181:342/406 of P50456
- H247 (= H157) binding
- C257 (= C172) binding ; mutation to A: Strongly reduced activity; when associated with A-259.; mutation to S: Strongly reduced activity; when associated with S-259.
- C259 (≠ F174) binding ; mutation to A: Strongly reduced activity; when associated with A-257.; mutation to S: Strongly reduced activity; when associated with S-257.
- C264 (= C178) binding
- R306 (≠ V207) mutation to G: Forms dimers but not tetramers; when associated with G-310.
- L310 (= L211) mutation to G: Forms dimers but not tetramers; when associated with G-306.
Sites not aligning to the query:
- 52 R→H: Shows increased expression and forms larger colonies.
- 86 H→R: Can be bound and inactivated by MtfA.
- 136 F→A: Decreases association with PtsG EIIB domain.
1z6rA Crystal structure of mlc from escherichia coli (see paper)
31% identity, 48% coverage: 93:231/291 of query aligns to 157:318/382 of 1z6rA
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
25% identity, 70% coverage: 27:231/291 of query aligns to 105:336/396 of 5f7qE
Sites not aligning to the query:
- binding : 5, 8, 12, 15, 32, 43, 44, 67, 68, 68, 69, 69, 70, 70, 71, 72, 73
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
44% identity, 37% coverage: 83:190/291 of query aligns to 81:186/298 of 3vovB
Query Sequence
>Ga0059261_4061 FitnessBrowser__Korea:Ga0059261_4061
MSDMRTWLAIETGGTKLLARLVRDEGVVAEARWPTTSPEAAEAALLAFAGRTPLAGVGIA
AFGPVVVDPAAANYGEVLATPKPGWTGANLRAALEQALGVPVAIDTDVNAAALAEAAAGA
GQGCSSLAYVTVGTGIGAGLARDGRTLTGALHPEMGHVPVLRFEGDPTPSACPFHSGCAE
GMAAGPAVQRRLGGKLLEDSPADFAAVADYLGQLFATIVLAWSPHRIVVGGGVMDVPGLG
KAATVRMRVALGGYGVGSAVGEADFIRSAALEHAGLEGALILARQAAARAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory