SitesBLAST
Comparing Ga0059261_4092 FitnessBrowser__Korea:Ga0059261_4092 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
43% identity, 52% coverage: 281:621/661 of query aligns to 1:324/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G311), G34 (= G314), T35 (= T315), I36 (= I316), D56 (= D336), H57 (≠ A337), S82 (= S364), I83 (= I365), A104 (= A386), A105 (= A387), A106 (= A388), K108 (= K390), N123 (≠ T405), I146 (≠ V428), K162 (= K444), F184 (= F472), G185 (= G473), N186 (= N474), V187 (= V475), S190 (= S478), S191 (= S479)
- binding uridine-5'-diphosphate: K150 (= K432), N186 (= N474), S193 (= S481), V194 (≠ L482), T209 (= T497), L210 (≠ V498), T211 (= T499), I215 (= I503), R217 (= R505), E279 (= E575)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
42% identity, 52% coverage: 281:621/661 of query aligns to 1:324/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G311), G34 (= G314), T35 (= T315), I36 (= I316), D56 (= D336), H57 (≠ A337), S82 (= S364), I83 (= I365), A104 (= A386), A105 (= A387), A106 (= A388), K108 (= K390), N123 (≠ T405), I146 (≠ V428), K162 (= K444), F184 (= F472), G185 (= G473), N186 (= N474), V187 (= V475), S190 (= S478), S191 (= S479)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K390), H109 (= H391), T148 (= T430), G185 (= G473), N186 (= N474), S193 (= S481), V194 (≠ L482), T209 (= T497), L210 (≠ V498), T211 (= T499), I215 (= I503), R217 (= R505), R276 (= R572), E279 (= E575)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
32% identity, 46% coverage: 305:607/661 of query aligns to 6:294/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G311), T14 (≠ G313), G15 (= G314), T16 (= T315), I17 (= I316), S37 (≠ D336), R38 (≠ A337), S39 (≠ N338), D63 (≠ S364), I64 (= I365), V83 (≠ A386), A84 (= A387), K87 (= K390), T125 (≠ V428), S127 (≠ T430), Y137 (≠ M440), K141 (= K444), F167 (= F472), V170 (= V475), S173 (= S478), R174 (≠ S479)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K390), H88 (= H391), S127 (≠ T430), N128 (≠ D431), Y137 (≠ M440), N169 (= N474), S176 (= S481), V177 (≠ L482), L180 (= L485), T192 (= T497), T194 (= T499), M198 (≠ I503), R200 (= R505), L234 (≠ V545), E265 (= E575)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
30% identity, 46% coverage: 300:601/661 of query aligns to 2:283/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K390), S176 (= S481), V177 (≠ L482), T195 (= T499), M199 (≠ I503), R201 (= R505), M235 (≠ V545), R254 (= R572), E257 (= E575)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G311), T15 (≠ G313), G16 (= G314), S17 (≠ T315), F18 (≠ I316), S39 (≠ A337), R40 (≠ N338), D41 (≠ E339), K44 (≠ Y343), D63 (≠ S364), V64 (≠ I365), A83 (= A386), A84 (= A387), A85 (= A388), K87 (= K390), L125 (≠ V428), S126 (= S429), Y137 (≠ M440), K141 (= K444), Y167 (≠ F472), G168 (= G473), V170 (= V475)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
30% identity, 46% coverage: 300:601/661 of query aligns to 2:283/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G311), T15 (≠ G313), G16 (= G314), S17 (≠ T315), F18 (≠ I316), R40 (≠ N338), D41 (≠ E339), K44 (≠ Y343), D63 (≠ S364), V64 (≠ I365), A83 (= A386), A84 (= A387), A85 (= A388), K87 (= K390), L125 (≠ V428), S126 (= S429), K141 (= K444), Y167 (≠ F472), G168 (= G473), V170 (= V475), R174 (≠ S479)
- binding uridine-5'-diphosphate-glucose: K87 (= K390), T127 (= T430), K129 (= K432), Y137 (≠ M440), N169 (= N474), S176 (= S481), V177 (≠ L482), P193 (≠ T497), T195 (= T499), M199 (≠ I503), R201 (= R505), M235 (≠ V545), R254 (= R572), E257 (= E575)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
30% identity, 46% coverage: 300:601/661 of query aligns to 2:283/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G311), T15 (≠ G313), G16 (= G314), S17 (≠ T315), F18 (≠ I316), R40 (≠ N338), D41 (≠ E339), K44 (≠ Y343), D63 (≠ S364), V64 (≠ I365), A84 (= A387), A85 (= A388), K87 (= K390), S126 (= S429), Y137 (≠ M440), K141 (= K444), Y167 (≠ F472), G168 (= G473), V170 (= V475), S173 (= S478), R174 (≠ S479)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K390), D128 (= D431), K129 (= K432), N169 (= N474), G175 (= G480), S176 (= S481), V177 (≠ L482), P193 (≠ T497), I194 (≠ V498), M199 (≠ I503), R201 (= R505), M235 (≠ V545), R254 (= R572), E257 (= E575)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
30% identity, 46% coverage: 300:601/661 of query aligns to 2:283/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G311), T15 (≠ G313), G16 (= G314), S17 (≠ T315), F18 (≠ I316), S39 (≠ A337), R40 (≠ N338), D41 (≠ E339), K44 (≠ Y343), D63 (≠ S364), V64 (≠ I365), A83 (= A386), A84 (= A387), A85 (= A388), K87 (= K390), T102 (= T405), L125 (≠ V428), S126 (= S429), T127 (= T430), Y137 (≠ M440), K141 (= K444), Y167 (≠ F472), G168 (= G473), V170 (= V475), S173 (= S478), R174 (≠ S479)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K390), T127 (= T430), D128 (= D431), K129 (= K432), Y137 (≠ M440), N169 (= N474), S176 (= S481), V177 (≠ L482), P193 (≠ T497), T195 (= T499), M199 (≠ I503), R201 (= R505), M235 (≠ V545), R254 (= R572), E257 (= E575)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
30% identity, 46% coverage: 300:601/661 of query aligns to 6:287/333 of O25511
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
30% identity, 46% coverage: 301:601/661 of query aligns to 1:281/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G311), T13 (≠ G313), G14 (= G314), S15 (≠ T315), F16 (≠ I316), S37 (≠ A337), R38 (≠ N338), D39 (≠ E339), K42 (≠ Y343), D61 (≠ S364), V62 (≠ I365), A81 (= A386), A82 (= A387), A83 (= A388), K85 (= K390), T100 (= T405), L123 (≠ V428), S124 (= S429), K139 (= K444), Y165 (≠ F472), G166 (= G473), V168 (= V475), S171 (= S478), R172 (≠ S479)
- binding uridine-5'-diphosphate: K127 (= K432), N167 (= N474), V175 (≠ L482), P191 (≠ T497), I192 (≠ V498), T193 (= T499), M197 (≠ I503), R199 (= R505), M233 (≠ V545), R252 (= R572)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
34% identity, 43% coverage: 301:586/661 of query aligns to 1:269/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G311), T13 (≠ G313), G14 (= G314), S15 (≠ T315), F16 (≠ I316), S36 (≠ D336), R37 (≠ A337), D38 (≠ N338), K41 (≠ N341), D60 (≠ S364), V61 (≠ I365), A80 (= A386), A81 (= A387), A82 (= A388), K84 (= K390), T99 (= T405), L122 (≠ V428), K138 (= K444), Y164 (≠ F472)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
29% identity, 46% coverage: 307:610/661 of query aligns to 16:298/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G311), T22 (≠ G313), G23 (= G314), S24 (≠ T315), F25 (≠ I316), S45 (≠ D336), R46 (≠ A337), D47 (≠ N338), K50 (≠ N341), D69 (≠ S364), V70 (≠ I365), A89 (= A386), A90 (= A387), A91 (= A388), K93 (= K390), L131 (≠ V428), T133 (= T430), K147 (= K444), Y173 (≠ F472)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (≠ H391), V95 (= V392), K135 (= K432), N175 (= N474), S182 (= S481), V183 (≠ L482), L186 (= L485), T198 (= T497), T200 (= T499), M204 (≠ I503), V240 (≠ I546), R263 (= R572), E266 (= E575), Y278 (≠ S587)
Sites not aligning to the query:
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: 313, 314, 315, 316, 320
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
29% identity, 46% coverage: 307:610/661 of query aligns to 16:298/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K390), Q94 (≠ H391), N175 (= N474), S179 (= S478), R180 (≠ S479), S182 (= S481), V183 (≠ L482), L186 (= L485), T198 (= T497), I199 (≠ V498), T200 (= T499), M204 (≠ I503), R206 (= R505), V240 (≠ I546), R263 (= R572), E266 (= E575)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
30% identity, 42% coverage: 307:586/661 of query aligns to 8:269/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G311), T14 (≠ G313), G15 (= G314), F17 (≠ I316), S37 (≠ D336), R38 (≠ A337), D39 (≠ N338), K42 (≠ N341), D61 (≠ S364), V62 (≠ I365), R63 (= R366), A81 (= A386), A82 (= A387), A83 (= A388), K85 (= K390), S124 (= S429), T125 (= T430), K139 (= K444), Y165 (≠ F472), G166 (= G473)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 43% coverage: 281:562/661 of query aligns to 1:282/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G314), S41 (≠ T315), I42 (= I316), D62 (= D336), I63 (≠ A337), D92 (≠ R366), I93 (≠ Q367), L114 (≠ A386), S115 (≠ A387), A116 (= A388), K118 (= K390), V158 (= V428), D161 (= D431), K174 (= K444), V198 (= V475), S201 (= S478)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
25% identity, 43% coverage: 302:587/661 of query aligns to 3:251/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G311), S14 (≠ G313), G15 (= G314), S16 (≠ T315), L17 (≠ I316), R36 (≠ A337), D37 (≠ N338), D59 (≠ S364), I60 (= I365), A81 (= A386), A82 (= A387), A83 (= A388), K85 (= K390), V128 (= V428), Y140 (≠ M440), K144 (= K444), Y168 (≠ F472), G169 (= G473), V171 (= V475)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
24% identity, 32% coverage: 307:520/661 of query aligns to 6:187/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G311), T12 (≠ G313), G13 (= G314), S14 (≠ T315), F15 (≠ I316), S35 (≠ D336), R36 (≠ A337), D37 (≠ N338), K40 (≠ N341), D59 (≠ S364), V60 (≠ I365), A80 (= A387), A81 (= A388), K83 (= K390), L121 (≠ V428), T123 (= T430), K137 (= K444), Y163 (≠ F472), G164 (= G473)
3pvzB Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 36% coverage: 285:524/661 of query aligns to 3:230/300 of 3pvzB
- binding nicotinamide-adenine-dinucleotide: G38 (= G314), S39 (≠ T315), I40 (= I316), D60 (= D336), I61 (≠ A337), L89 (≠ I365), D90 (≠ R366), I91 (≠ Q367), L112 (≠ A386), S113 (≠ A387), A114 (= A388), K116 (= K390), D159 (= D431), K172 (= K444), N195 (= N474), V196 (= V475), S199 (= S478)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 19% coverage: 305:432/661 of query aligns to 2:136/355 of P27830
- FI 12:13 (≠ TI 315:316) binding
- DKLT 33:36 (≠ DANE 336:339) binding
- DI 59:60 (vs. gap) binding
- T100 (= T405) binding
- D135 (= D431) active site, Proton donor
- E136 (≠ K432) active site, Proton acceptor
Sites not aligning to the query:
- 160 active site, Proton acceptor
- 160:164 binding
- 190 binding
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
32% identity, 19% coverage: 305:432/661 of query aligns to 2:136/344 of 1bxkB
- active site: S125 (≠ G421), T134 (= T430), D135 (= D431), E136 (≠ K432)
- binding nicotinamide-adenine-dinucleotide: G8 (= G311), G11 (= G314), F12 (≠ T315), I13 (= I316), D33 (= D336), K34 (≠ A337), L35 (≠ N338), T36 (≠ E339), A38 (vs. gap), G39 (vs. gap), D59 (vs. gap), I60 (vs. gap), L81 (≠ A386), A83 (= A388), T100 (= T405), I132 (≠ V428), S133 (= S429), T134 (= T430)
Sites not aligning to the query:
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
23% identity, 39% coverage: 306:561/661 of query aligns to 2:260/309 of 4zrnA
- active site: T117 (= T430), G119 (≠ K432), A120 (= A433), Y143 (≠ M440), K147 (= K444), Y181 (vs. gap), G185 (≠ S481)
- binding nicotinamide-adenine-dinucleotide: G7 (= G311), G10 (= G314), F11 (≠ T315), I12 (= I316), D31 (= D336), N32 (= N341), S34 (≠ Y343), S35 (≠ D344), G36 (≠ A345), S51 (= S364), I52 (= I365), L73 (≠ A386), A74 (= A387), A75 (= A388), T92 (= T405), S115 (≠ V428), S116 (= S429), Y143 (≠ M440), K147 (= K444), Y170 (≠ F472), V173 (= V475)
- binding uridine-5'-diphosphate-glucose: T117 (= T430), G119 (≠ K432), A120 (= A433), Y143 (≠ M440), N172 (= N474), G185 (≠ S481), V186 (≠ L482), H201 (≠ T497), F203 (vs. gap), Y208 (≠ I503), R210 (= R505), V244 (= V545)
Sites not aligning to the query:
Query Sequence
>Ga0059261_4092 FitnessBrowser__Korea:Ga0059261_4092
MTITLENRSSSLIRASLIYLIDGVIAAVSLIAAISLRVGSLRAGQVLNEHLAAMPLFVVV
ALVTFAAMRLHRRVWRYTSTEEVFEVVKAATVAILAYVLLLILIGGAGWLPRSIPVIQWL
VLVVLMGGVRMARRLAAEYLGGRFHPPASAANPEHPKRTALLFGSSDDIEQLLRQLEGEP
NAAFRAVGILDETGAHTGARVRGVPVVGRPADLVSVVGSLTARDARPACLIFAGPVERLQ
RMAMVNIVAQAQSLDLEIAYRPGFIGFAPEPGASLDFRFLNVADLLGRPQAVLDDRAVAD
MIGGRRILVTGAGGTIGRELARQIAEHGPARLILLDANEFNLYDADLEMRESHPQVSCTP
VLCSIRQRRQLMQVFAEHRPELVFHAAALKHVPLVEMHPAAGVQTNVLGTRNVADAARFY
GALAMVQVSTDKAVNPVGFMGVTKRLGEFYCQALDLAGSDDPGAPRFITVRFGNVLGSSG
SLIPLFQRQLSRGGPLTVTHPEIERFFMTVHEAVQLILQSASRGLRDGMRHGRIFVLDMG
EPIRVIDIARRMIRLAGLDPEIDVGIDIIGLRPGEKLYEELFDAEESRLPSSIPGVFEAE
PRPIPLRTLNKTFDALERASDEADDAACVAIATGLLDRRRAPVADIAVVGARRPAIMAQA
G
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory