SitesBLAST
Comparing Ga0059261_4182 FitnessBrowser__Korea:Ga0059261_4182 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jnqA Crystal structure of a thioredoxin reductase from brucella melitensis
58% identity, 96% coverage: 1:311/323 of query aligns to 2:312/315 of 4jnqA
- active site: C137 (= C137), C140 (= C140), D141 (= D141)
- binding dihydroflavine-adenine dinucleotide: I12 (≠ L12), G13 (= G13), S14 (= S14), G15 (= G15), P16 (= P16), A17 (= A17), A36 (≠ Q36), G37 (= G37), Q39 (= Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), N52 (= N52), I85 (= I85), A113 (= A113), T114 (= T114), C140 (= C140), G283 (= G282), D284 (= D283), R291 (= R290), Q292 (= Q291), A293 (= A292)
P0A9P4 Thioredoxin reductase; TRXR; EC 1.8.1.9 from Escherichia coli (strain K12) (see 2 papers)
56% identity, 96% coverage: 1:310/323 of query aligns to 1:314/321 of P0A9P4
- M1 (= M1) modified: Initiator methionine, Removed
- 36:43 (vs. 36:43, 50% identical) binding
- C136 (= C137) modified: Disulfide link with 139, Redox-active
- C139 (= C140) modified: Disulfide link with 136, Redox-active
- 287:296 (vs. 283:292, 80% identical) binding
5vt3B High resolution structure of thioredoxin-disulfide reductase from vibrio vulnificus cmcp6 in complex with NADP and fad
56% identity, 96% coverage: 1:310/323 of query aligns to 3:315/319 of 5vt3B
- active site: C138 (= C137), C141 (= C140), D142 (= D141)
- binding flavin-adenine dinucleotide: G15 (= G13), S16 (= S14), G17 (= G15), P18 (= P16), A19 (= A17), T38 (≠ Q36), G39 (= G37), Q41 (= Q39), G44 (= G42), Q45 (= Q43), L46 (= L44), T49 (= T47), N54 (= N52), H86 (≠ T84), I87 (= I85), S114 (≠ A113), T115 (= T114), G116 (= G115), E162 (= E161), H247 (= H245), G287 (= G282), D288 (= D283), R295 (= R290), Q296 (= Q291), A297 (= A292), S300 (≠ A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L122 (= L121), G156 (= G155), G157 (= G156), N158 (= N157), T159 (= T158), H178 (= H177), R179 (= R178), R180 (= R179), R184 (= R183), I245 (= I243), G246 (= G244), R295 (= R290), Q296 (= Q291)
1f6mA Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the NADP+ analog, aadp+ (see paper)
56% identity, 95% coverage: 4:310/323 of query aligns to 3:313/320 of 1f6mA
- active site: S135 (≠ C137), C138 (= C140), D139 (= D141)
- binding 3-aminopyridine-adenine dinucleotide phosphate: L119 (= L121), G153 (= G155), G154 (= G156), N155 (= N157), T156 (= T158), E159 (= E161), H175 (= H177), R176 (= R178), R177 (= R179), R181 (= R183), I243 (= I243), G244 (= G244), H245 (= H245), R293 (= R290), Q294 (= Q291)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (≠ Q36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (≠ T84), I84 (= I85), A111 (= A113), T112 (= T114), G113 (= G115), H245 (= H245), G285 (= G282), D286 (= D283), R293 (= R290), Q294 (= Q291), A295 (= A292), S298 (≠ A295)
1tdfA Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis (see paper)
56% identity, 95% coverage: 4:310/323 of query aligns to 3:313/316 of 1tdfA
- active site: C135 (= C137), S138 (≠ C140), D139 (= D141)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), T35 (≠ Q36), G36 (= G37), E38 (≠ Q39), G41 (= G42), Q42 (= Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), H83 (≠ T84), I84 (= I85), A111 (= A113), T112 (= T114), S138 (≠ C140), G285 (= G282), D286 (= D283), R293 (= R290), Q294 (= Q291), A295 (= A292), S298 (≠ A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L119 (= L121), I151 (= I153), T156 (= T158), E159 (= E161), H175 (= H177), R176 (= R178), R181 (= R183), E183 (= E185), I243 (= I243), G244 (= G244), H290 (≠ K287), R293 (= R290)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
55% identity, 96% coverage: 1:310/323 of query aligns to 4:316/319 of 5u63B
- active site: C139 (= C137), C142 (= C140), D143 (= D141)
- binding flavin-adenine dinucleotide: G16 (= G13), S17 (= S14), G18 (= G15), P19 (= P16), A20 (= A17), T39 (≠ Q36), G40 (= G37), Q42 (= Q39), G45 (= G42), Q46 (= Q43), L47 (= L44), T50 (= T47), N55 (= N52), H87 (≠ T84), I88 (= I85), A115 (= A113), T116 (= T114), G117 (= G115), H248 (= H245), G288 (= G282), D289 (= D283), R296 (= R290), Q297 (= Q291), A298 (= A292), S301 (≠ A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (≠ K119), G157 (= G155), H179 (= H177), R180 (= R178), R181 (= R179), I246 (= I243), G247 (= G244), H248 (= H245), R296 (= R290)
Q39243 Thioredoxin reductase 1, mitochondrial; NADPH-dependent thioredoxin reductase 1; NTR1; NADPH-dependent thioredoxin reductase B; AtNTRB; EC 1.8.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
53% identity, 96% coverage: 4:312/323 of query aligns to 48:366/375 of Q39243
- SGPA 58:61 (= SGPA 14:17) binding
- FE 79:80 (≠ VQ 35:36) binding
- IAPGGQ 87:92 (≠ IQPGGQ 38:43) binding
- N101 (= N52) binding
- V134 (≠ I85) binding
- C189 (= C137) modified: Disulfide link with 192, Redox-active
- C192 (= C140) binding ; modified: Disulfide link with 189, Redox-active
- D337 (= D283) binding
- RQA 344:346 (= RQA 290:292) binding
Sites not aligning to the query:
- 1:37 modified: transit peptide, Mitochondrion
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
53% identity, 94% coverage: 9:312/323 of query aligns to 6:305/306 of 5uthA
- active site: C133 (= C137), C136 (= C140), D137 (= D141)
- binding flavin-adenine dinucleotide: I9 (≠ L12), G10 (= G13), S11 (= S14), G12 (= G15), P13 (= P16), A14 (= A17), F32 (≠ V35), E33 (≠ Q36), G34 (= G37), Q36 (= Q39), G39 (= G42), A40 (≠ Q43), L41 (= L44), N49 (= N52), D81 (≠ T84), V82 (≠ I85), M110 (≠ T114), G111 (= G115), C136 (= C140), G275 (= G282), D276 (= D283), R283 (= R290), Q284 (= Q291), A285 (= A292), A288 (= A295)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
53% identity, 94% coverage: 9:312/323 of query aligns to 5:304/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ T84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (≠ K119), H115 (≠ W120), L116 (= L121), R173 (= R178), E200 (= E205), I201 (≠ V206), I235 (= I243)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
53% identity, 94% coverage: 9:312/323 of query aligns to 5:304/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ T84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (= L121), R173 (= R178), E200 (= E205), I201 (≠ V206)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
53% identity, 94% coverage: 9:312/323 of query aligns to 5:304/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ T84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (≠ K119), H115 (≠ W120), L116 (= L121), V148 (≠ I153), R173 (= R178), E200 (= E205), I201 (≠ V206)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
53% identity, 94% coverage: 9:312/323 of query aligns to 5:304/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), E32 (≠ Q36), G33 (= G37), Q35 (= Q39), G38 (= G42), A39 (≠ Q43), L40 (= L44), T43 (= T47), N48 (= N52), D80 (≠ T84), V81 (≠ I85), M109 (≠ T114), G110 (= G115), T131 (≠ A136), C135 (= C140), G274 (= G282), D275 (= D283), R282 (= R290), Q283 (= Q291), A284 (= A292), A287 (= A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G155), G151 (= G156), D152 (≠ N157), S153 (≠ T158), E156 (= E161), H172 (= H177), R173 (= R178), R174 (= R179), R178 (= R183), I235 (= I243)
1vdcA Structure of NADPH dependent thioredoxin reductase (see paper)
53% identity, 96% coverage: 4:312/323 of query aligns to 3:321/322 of 1vdcA
- active site: C144 (= C137), C147 (= C140), D148 (= D141)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), F34 (≠ V35), E35 (≠ Q36), G36 (= G37), A39 (vs. gap), I42 (= I38), G46 (= G42), Q47 (= Q43), L48 (= L44), V54 (= V50), N56 (= N52), T88 (= T84), V89 (≠ I85), I117 (≠ T114), G118 (= G115), C147 (= C140), G291 (= G282), D292 (= D283), R299 (= R290), Q300 (= Q291), A301 (= A292), A304 (= A295)
2whdB Barley NADPH-dependent thioredoxin reductase 2 (see paper)
52% identity, 95% coverage: 7:312/323 of query aligns to 7:318/319 of 2whdB
- active site: C141 (= C137), C144 (= C140), D145 (= D141)
- binding flavin-adenine dinucleotide: G13 (= G13), S14 (= S14), G15 (= G15), P16 (= P16), A17 (= A17), G37 (= G37), A40 (vs. gap), G47 (= G42), Q48 (= Q43), L49 (= L44), T52 (= T47), N57 (= N52), T89 (= T84), V90 (≠ I85), T118 (= T114), G119 (= G115), C144 (= C140), G288 (= G282), D289 (= D283), R296 (= R290), Q297 (= Q291), A298 (= A292)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
50% identity, 96% coverage: 3:312/323 of query aligns to 10:317/335 of P9WHH1
- SGPA 22:25 (= SGPA 14:17) binding
- Y32 (= Y24) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 36:43, 38% identical) binding
- N60 (= N52) binding
- V93 (≠ I85) binding
- C145 (= C137) modified: Disulfide link with 148, Redox-active
- C148 (= C140) modified: Disulfide link with 145, Redox-active
- S166 (≠ T158) binding
- H185 (= H177) binding
- R191 (= R183) binding
- I248 (= I243) binding
- Y268 (= Y263) binding
- D288 (= D283) binding
- R295 (= R290) binding
- RQAV 295:298 (≠ RQAI 290:293) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
50% identity, 96% coverage: 3:312/323 of query aligns to 1:308/313 of 2a87A
- active site: F39 (≠ P40), L43 (= L44), D48 (= D49), C136 (= C137), C139 (= C140), D140 (= D141)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (= S14), G14 (= G15), P15 (= P16), A16 (= A17), F34 (≠ V35), E35 (≠ Q36), G36 (= G37), G40 (= G41), G41 (= G42), A42 (≠ Q43), L43 (= L44), T46 (= T47), V49 (= V50), N51 (= N52), D83 (≠ T84), V84 (≠ I85), M113 (≠ T114), C139 (= C140), G278 (= G282), D279 (= D283), R286 (= R290), Q287 (= Q291), A288 (= A292), V289 (≠ I293)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (= L121), G155 (= G156), D156 (≠ N157), S157 (≠ T158), H176 (= H177), R177 (= R178), R178 (= R179), R182 (= R183), I239 (= I243), Y259 (= Y263), R283 (≠ K287), R286 (= R290)
5w4cA Crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation)
49% identity, 97% coverage: 7:318/323 of query aligns to 18:340/356 of 5w4cA
- binding calcium ion: E99 (≠ D83), E116 (vs. gap), E118 (≠ V98)
- binding flavin-adenine dinucleotide: I23 (≠ L12), G24 (= G13), S25 (= S14), P27 (= P16), G28 (≠ A17), Y46 (≠ V35), G48 (= G37), A51 (vs. gap), F54 (vs. gap), G58 (= G42), Q59 (= Q43), L60 (= L44), T63 (= T47), N68 (= N52), V101 (≠ I85), T134 (= T114), G135 (= G115), G302 (= G282), D303 (= D283), R310 (= R290), Q311 (= Q291), A312 (= A292), S315 (≠ A295)
Sites not aligning to the query:
6bpyA Aspergillus fumigatus thioredoxin reductase (see paper)
47% identity, 95% coverage: 7:314/323 of query aligns to 3:323/324 of 6bpyA
- binding flavin-adenine dinucleotide: I8 (≠ L12), G9 (= G13), S10 (= S14), G11 (= G15), P12 (= P16), A13 (= A17), Y31 (≠ V35), E32 (≠ Q36), G33 (= G37), A36 (vs. gap), T38 (vs. gap), A39 (≠ Q39), G42 (= G42), Q43 (= Q43), L44 (= L44), T47 (= T47), I50 (≠ V50), N52 (= N52), T84 (= T84), I85 (= I85), T120 (= T114), G121 (= G115), C146 (= C140), G291 (= G282), D292 (= D283), R299 (= R290), Q300 (= Q291), A301 (= A292), S304 (≠ A295)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G163 (= G155), G164 (= G156), S166 (≠ T158), R186 (= R178), R187 (= R179), R191 (= R183), V252 (≠ I243)
Q70G58 Thioredoxin reductase NTRC; NADPH-dependent thioredoxin reductase C; OsNTRC; EC 1.8.1.9 from Oryza sativa subsp. japonica (Rice) (see 2 papers)
48% identity, 95% coverage: 9:315/323 of query aligns to 72:382/515 of Q70G58
- C203 (= C137) mutation to S: Loss of thioredoxin reductase activity.
- C206 (= C140) mutation to S: Loss of thioredoxin reductase activity.
- A227 (= A159) mutation to G: Reduces activity 30-fold; when associated with E-245 and F-246.
- V245 (≠ H177) mutation to E: Reduces activity 30-fold; when associated with G-227 and F-246.
- R246 (= R178) mutation to F: Reduces activity 30-fold; when associated with G-227 and E-245.
Sites not aligning to the query:
- 440 C→S: Loss of thioredoxin activity.
- 443 C→S: Loss of thioredoxin activity.
7p9eB Chlamydomonas reinhardtii NADPH dependent thioredoxin reductase 1 domain cs mutant (see paper)
49% identity, 93% coverage: 9:310/323 of query aligns to 4:304/316 of 7p9eB
- binding flavin-adenine dinucleotide: G8 (= G13), S9 (= S14), G10 (= G15), P11 (= P16), A12 (= A17), E31 (≠ Q36), G32 (= G37), N35 (≠ P40), G36 (= G41), G39 (= G42), Q40 (= Q43), L41 (= L44), T44 (= T47), N49 (= N52), D81 (≠ T84), V82 (≠ I85), A109 (= A113), T110 (= T114), W126 (≠ K130), S136 (≠ C140), G276 (= G282), D277 (= D283), R284 (= R290), Q285 (= Q291), A286 (= A292), A289 (= A295)
Query Sequence
>Ga0059261_4182 FitnessBrowser__Korea:Ga0059261_4182
MTATHSTRMLILGSGPAGLSAAIYGARAGLAPIVVQGIQPGGQLMTTTDVENYPGFREVI
QGPWLMGEMQAQAEHVGAQMLYDTIVEVDLTRRPFRMVGDSGTVYLGDTLVIATGAQAKW
LGLDSEEAMKGKGASACATCDGFFYRGKKVAVIGGGNTAVEEALYLTNHSHDVTLIHRRD
SLRAEKILQQRLFANPKIKTLWNKEVVEFVGGGDPEGLVGLKLRDTVTGELSDIDVEGGF
VAIGHHPATELFRGHLKLDSDSYIEVETGTTRTSVPGVFACGDVMDKVYRQAITAAGTGC
MAALDAERFLAEADFEAVAEAAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory