Comparing Ga0059261_4225 FitnessBrowser__Korea:Ga0059261_4225 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
41% identity, 97% coverage: 7:208/209 of query aligns to 543:750/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 91% coverage: 1:190/209 of query aligns to 1:192/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 68% coverage: 7:148/209 of query aligns to 3:132/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
35% identity, 68% coverage: 7:148/209 of query aligns to 3:132/167 of 2pkpA
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
36% identity, 34% coverage: 64:134/209 of query aligns to 655:737/778 of P19414
Sites not aligning to the query:
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
30% identity, 47% coverage: 18:115/209 of query aligns to 612:709/780 of P20004
Sites not aligning to the query:
P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
40% identity, 34% coverage: 52:123/209 of query aligns to 751:827/889 of P21399
Sites not aligning to the query:
2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
40% identity, 34% coverage: 52:123/209 of query aligns to 750:826/888 of 2b3xA
Sites not aligning to the query:
>Ga0059261_4225 FitnessBrowser__Korea:Ga0059261_4225
MEPVKKVEGRAYPWGAKNIDTDIIIPAHWLKTISREGLGKGAFESVRAEPDNIFDDARYA
GSPILIAGENFGCGSSREHAAWALKDMGVTAVIAPSYSDIFSGNAFKNGIVAVVLPQDAV
DRLVEVAKTDPVTIDLETMTVTTPYQDRFAFEMDPFRRDCLMQGLDEVGLTLAKDTVISK
YESTVAQSRPWIARERADEGLAVAGSGRT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory